SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 448385.sce9256 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  448385.sce9256
Domain Number 1 Region: 298-417
Classification Level Classification E-value
Superfamily Collagen-binding domain 0.0000484
Family Collagen-binding domain 0.01
Further Details:      
 
Weak hits

Sequence:  448385.sce9256
Domain Number - Region: 133-242
Classification Level Classification E-value
Superfamily Collagen-binding domain 0.00034
Family Collagen-binding domain 0.017
Further Details:      
 
Domain Number - Region: 679-809
Classification Level Classification E-value
Superfamily Collagen-binding domain 0.00116
Family Collagen-binding domain 0.017
Further Details:      
 
Domain Number - Region: 491-607
Classification Level Classification E-value
Superfamily Collagen-binding domain 0.00575
Family Collagen-binding domain 0.017
Further Details:      
 
Domain Number - Region: 1011-1128
Classification Level Classification E-value
Superfamily Collagen-binding domain 0.0615
Family Collagen-binding domain 0.013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) 448385.sce9256
Sequence length 1145
Comment (Sorangium cellulosum So ce 56 )
Sequence
MPAVGGNGGEGGSGGEGGSGGEGGSGGESGSGGEGGSGGESGSGGQGGAAGAVCGDGAVS
APVEVCDDGNRTAGDGCDPGCAIEPGFACAGAPSVCTSGCGDGVLGGAETCDDGGDKDGD
CCSRACQVEPGCEVEPNDEFASANDAFAIAPGGRIRAFIDPESDVDVFSVTVPEGSVGRI
KAETLDGPLGTTCSSFGVDTHLTIFDASLVSIEDNDDVADDDTCSFLALRKLSPGEYFVR
VQISPGAEPATFDYTLSLTLDTSVCGDGVLEDPELCDDGDTTGGDGCSAACELELRSPEV
EPNGTAAEAGGRAALRPNVLVSAAIEPLGDIDVFAFEVPSLADVQLATFSPGRLDECAEG
VDTFLQLLDVDGATVLASDDDSGLEACSLIDSSVDDRATRLQPGTYYVTVEEFNNDASIP
GYDLLIAFTSLCGNGVIEEGEACDGGERCSSACARIAVCGDGAIDGGEACDDGGTEGGDG
CSAACQLEGTLPEIEPNDARGQATAGRATAAGALFTASISPPGEVDFFAIDVPGLAELEV
ETFDATGPTSCRGIDTVVRLLAPDGAVIAEDNDGGEARCSRIRAAVTAPGVDYVRYYVRV
QDYGGDSIAGYTVRARTTAVCGDGAVEGLEECDGGAACGATCQRVPVCGDGFVDEPEVCD
DGNTGGGDGCDAACRIEGAIAEIEPNSTPAEAEANGAIAPGALVSGAIEPDSDVDLFALQ
LTSVSDLRLETFDSSGPARCAEGVDTVLSLLSPDGATVLASDDDGGIGACSLIDSRSPGG
AAARRLGPGTYHVRVSGFPEQPGARYTLRVSLDASCGDGVREGAEECDGGAGCSARCERL
PVCGDGLLDAPEGCDDGNAAGGDGCSPACQLEAVTAEIEPNDTPAQAGASDLVISGDALL
AASLAAGGDRDVFRLSLPVASVVRLEVFDGTAAGCEGGLLTTLRVLDAAGGTVATDEGLS
DAAYAGGIGGCSALVMALPSGDHDVEVAAREGGAEFPLYLLQAKILAPAGAEEEPNGTIA
TASGFAGSDVFIAGARATDDFDFYAVDVPEGRSIRAEIIEGGEEACESLDIDSRLSLLDA
AGALIADDDDGGRGNCSILDGTGDAPRHPGAHALPAGRYFLRVRAASGASGTAALFAYRL
AVTLR
Download sequence
Identical sequences A9GE17
WP_012241864.1.90317 448385.sce9256 gi|162457542|ref|YP_001619909.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]