SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 449447.MAE_03470 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  449447.MAE_03470
Domain Number 1 Region: 535-643
Classification Level Classification E-value
Superfamily CalX-like 4.84e-24
Family CalX-beta domain 0.0043
Further Details:      
 
Domain Number 2 Region: 157-284
Classification Level Classification E-value
Superfamily beta-Roll 9.42e-22
Family Serralysin-like metalloprotease, C-terminal domain 0.00059
Further Details:      
 
Domain Number 3 Region: 418-531
Classification Level Classification E-value
Superfamily CalX-like 3.4e-21
Family CalX-beta domain 0.0025
Further Details:      
 
Domain Number 4 Region: 304-399
Classification Level Classification E-value
Superfamily beta-Roll 5.41e-18
Family Serralysin-like metalloprotease, C-terminal domain 0.0012
Further Details:      
 
Domain Number 5 Region: 325-381,647-774
Classification Level Classification E-value
Superfamily beta-Roll 0.0000000000183
Family Serralysin-like metalloprotease, C-terminal domain 0.0011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) 449447.MAE_03470
Sequence length 836
Comment (Microcystis aeruginosa NIES 843)
Sequence
MTSSLLPILPAVDDVLFNFAQSDGFWANLAIAFGASYDVVKATELRQQWKSRNFSQLPPI
EVLSGEVLGTANGAYSSSTNKIYLSASFLNTASSAAIINVILEEIGHYVDAQVNQVDSAG
DEGAIFAELVQGNSLDVATLEALRAENDQTTIIVNGEIIQVEQADFTGTNGNDNITGTSG
DDNIYGLGGNDTLSGLAGNDRLEGGSGNNTLYGGTGNDVFNFAYPLNTNTSDVAMDFVQG
QDKIDVSSLNLSDWATLQLLISNDGKNNALITTFFDGVQSQLKLNGINPTLLQASDFIFN
TINLNQSIDGDDFYTYNDQLFGGLGNDTLRGFKGNDTLFGEQGDDRLDGGSGSDTLYGGL
GDDTAVYTGNRSQYSWTSNQGVFTITDSVANRDGIDTLYGIQKLQFSDQIVTIAPEEDFP
SITLAVSPSSVTEDGTANLVYTFTRSGSTTNPLTVNYSIGGTATNGTDYASIPTGVIFAA
NSATVTVIVDPTADTIVESNETVILTLASGTGYTVGTPNAATGTITDDDTSVTSQLSIND
ITVVEGKDNHAILTVTVDNPNPQPITFNYTTAPINATANVDYTSKTGTITIAANTATATI
SIPILNDNLNEPDEAFTVTLSNPVNATINPEGGIGEVIITDTWQSTLTRTLPNNVENLRL
IGSNNINGTGNAGNNKITGNSGINQINGRAGIDTLTGGLGADTFIFQFGQSTISTRDRIT
DFAINSDKIDLLTQGGTATSAPSNFSRAANSTVTTLQNLINQVFTDANGATTGNQGLGVN
SAALVQVTTGAIAGTYLVINDSAAGFQSSNDLLINITGFTGALPALGNIPVGNFFV
Download sequence
Identical sequences B0JN05
449447.MAE_03470 WP_012264031.1.4043 gi|166363088|ref|YP_001655361.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]