SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 449447.MAE_11040 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  449447.MAE_11040
Domain Number 1 Region: 1-164
Classification Level Classification E-value
Superfamily Thiamin diphosphate-binding fold (THDP-binding) 1.96e-42
Family TK-like Pyr module 0.0083
Further Details:      
 
Domain Number 2 Region: 171-300
Classification Level Classification E-value
Superfamily TK C-terminal domain-like 5.5e-20
Family Branched-chain alpha-keto acid dehydrogenase beta-subunit, C-terminal-domain 0.026
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) 449447.MAE_11040
Sequence length 303
Comment (Microcystis aeruginosa NIES 843)
Sequence
MRNAFSDALVKFALGDERVLLLTGDHGYALFDDFRQACPKQYINAGVAEQNMVGVAAGLA
KSGFFPVVYGLSSFLPIRVLEQIKLDICYEQLKVLLIGDGAGVVYSSLGSSHQSTEDIAA
LRALPNISILSPADASEMTQCLNWAFNSDRPVYLRMGKADLGVIHETLPNLEPGKLYPVK
PGTGNLGFLATGSMVKTALEVAQEWDNSGVWSVPFIKPLDVQQVREICQQYQAIVVIEEH
SIYGGLGAAISEIASTYHPSWICRIGIEDRFSQFCGTYQYLMQEHRLDVTSVKEKVRNFM
SRL
Download sequence
Identical sequences B0JSN2
gi|166363845|ref|YP_001656118.1| 449447.MAE_11040 WP_012264579.1.4043

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]