SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 449447.MAE_12400 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  449447.MAE_12400
Domain Number 1 Region: 230-526
Classification Level Classification E-value
Superfamily Subtilisin-like 9.95e-84
Family Subtilases 0.00000326
Further Details:      
 
Domain Number 2 Region: 842-951
Classification Level Classification E-value
Superfamily CalX-like 1.83e-19
Family CalX-beta domain 0.0014
Further Details:      
 
Domain Number 3 Region: 1190-1282
Classification Level Classification E-value
Superfamily CalX-like 2.88e-19
Family CalX-beta domain 0.0017
Further Details:      
 
Domain Number 4 Region: 1412-1506
Classification Level Classification E-value
Superfamily CalX-like 1.7e-18
Family CalX-beta domain 0.0016
Further Details:      
 
Domain Number 5 Region: 968-1060
Classification Level Classification E-value
Superfamily CalX-like 1.7e-18
Family CalX-beta domain 0.0017
Further Details:      
 
Domain Number 6 Region: 1079-1171
Classification Level Classification E-value
Superfamily CalX-like 1.7e-18
Family CalX-beta domain 0.0017
Further Details:      
 
Domain Number 7 Region: 2321-2467
Classification Level Classification E-value
Superfamily beta-Roll 2.62e-18
Family Serralysin-like metalloprotease, C-terminal domain 0.0002
Further Details:      
 
Domain Number 8 Region: 1523-1615
Classification Level Classification E-value
Superfamily CalX-like 3.4e-18
Family CalX-beta domain 0.0018
Further Details:      
 
Domain Number 9 Region: 2078-2170
Classification Level Classification E-value
Superfamily CalX-like 1.83e-17
Family CalX-beta domain 0.0025
Further Details:      
 
Domain Number 10 Region: 1743-1839
Classification Level Classification E-value
Superfamily CalX-like 1.83e-17
Family CalX-beta domain 0.0017
Further Details:      
 
Domain Number 11 Region: 1301-1393
Classification Level Classification E-value
Superfamily CalX-like 3.01e-17
Family CalX-beta domain 0.0021
Further Details:      
 
Domain Number 12 Region: 1634-1726
Classification Level Classification E-value
Superfamily CalX-like 3.01e-17
Family CalX-beta domain 0.0021
Further Details:      
 
Domain Number 13 Region: 1854-1950
Classification Level Classification E-value
Superfamily CalX-like 3.27e-17
Family CalX-beta domain 0.002
Further Details:      
 
Domain Number 14 Region: 1967-2059
Classification Level Classification E-value
Superfamily CalX-like 8.37e-17
Family CalX-beta domain 0.0022
Further Details:      
 
Domain Number 15 Region: 529-657
Classification Level Classification E-value
Superfamily CalX-like 0.000000000000732
Family CalX-beta domain 0.0078
Further Details:      
 
Domain Number 16 Region: 2223-2339
Classification Level Classification E-value
Superfamily beta-Roll 0.0000000000107
Family Serralysin-like metalloprotease, C-terminal domain 0.00035
Further Details:      
 
Weak hits

Sequence:  449447.MAE_12400
Domain Number - Region: 664-833
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 0.0106
Family MAM domain 0.064
Further Details:      
 
Domain Number - Region: 128-198
Classification Level Classification E-value
Superfamily Protease propeptides/inhibitors 0.0111
Family Subtilase propeptides/inhibitors 0.0063
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) 449447.MAE_12400
Sequence length 2534
Comment (Microcystis aeruginosa NIES 843)
Sequence
MPSLADSLSFDGAFPITADLTGSGDLSVSIETPPLGVLNSNSSPSTVSSEAPTVSASPTA
KSSPLFPAPLSINSSRYSTSPGLGLASVPAAAPVTTSPGLGLASVPTAAPVTSELEPAAT
RTLAPHAPNQLIVKFKQGIASAQVAQFQSLFGAVRTQTIKLTGAQVWKLSGSLSVEKILA
QYRSNPIFEYIEPDYIRTVGAFTPQATFPNYPSFNQLWGLHNTGQNGGTPDADIDAPEAW
DIQTGNPNLVIGVIDTGVDYNHQDLVGNIWTNPGEIANDGIDNDGNGYIDDIRGWDFAYN
DNNPSDVYGHGTHVSGTIAGKGNNGVGVTGVAWNAKIMPLKFLNDQGSGSTSNAIKAINY
ATAKGVKLTNNSWGGGGFSQALYDAINAAGQAGALFIAAAGNSSANADINPMYPAAYNLA
NIISVASTTRTDALSSFSNYGLTSVDLGAPGSDIYSTTPNNNYATYSGTSMASPHVTGAA
ALLWSQNPTWTAQQVKNTLMNTGDPLASLAGKTVSGKRLNVFNALGANLPSVTVSVSPAS
VQEDGTTNLVYTFTRTNLNLSSPLTVNFGASGIANAAPVGSDPADYNVLTGSGVIFDPTT
KLGTVTFAAGATTATVVVDPIADTVQENSESVILTVNSGTGYIDGSPNTATGTIISEEGF
TTYFSDDFANNTKGWTLGKEWQIGAATTSTGQNYGNPDPGTDNTPTADNGVAGVVIGGNA
STALHGFYYLTSPVINTSTANKLFFEFARWLNSDYTPFVQNKVEIFNGSSWVNLLPNNFD
EAPGVQDNAWTPQQFDISAYKSASTQIRFGFNVGSTDVFTVSSWNLDDVKIYGDGGITTK
SISIAKTTDGKEAGSVSSVFTLTRTGDLSSALTVNYTLAGTATLGSDYNDPGAGKATFAA
GSSKATIILPTIDDSVVDPSETIITKITAPTGYTISGPDTATATIIDDDLGTLTLGKTTD
GKEAGLVSSVFTLTRTGDLSSALTVNYTLAGTATLGSDYNDPSLGQATFVAGSPTATITL
PTIDDSVVDPSETIITKITAPTGYTISGPDTATATIIDDDLGTLTLGKTTDGKEAGLVSS
VFTLTRTGDLSSALTVNYTLAGTATLGSDYNDPSLGQATFVAGSPTATITLPTIDDSVVD
PSETIITKITAPTGYTISGPDTATATIIDDDLGTLTLGKTTDGKEAGLVSSVFTLTRTGD
LSSALTVNYTLAGTATLGSDYNDPSLGQATFAAGSPTATITLPTIDDSVVDPSETIITTI
TAPTGYTISGPDTATATIIDDDLGTLTLGKTTDGKEAGLVSSVFTLTRTGDLSSALTVNY
TLAGTATLGSDYNDPSLGQATFAAGADKATIILPTTDDIVVDPSETIITTITAPTGYTIS
GPDTATATIIDDDLGTLTLGKTTDGKEAGLVSSVFTLTRTGDLSSALTVNYTLAGTATLG
SDYNDPSLGQATFAAGADKATIILPTIDDSVVDPSETIITTITAPTGYTISGPDTATATI
IDDDLGTLTLGKTTDGKEAGLVSSVFTLTRTGDLSSALTVTYTLAGTATLGSDYNDPSLG
QATFVAGSPTATITLPTIDDSVVDPSETIITKITAPTGYTISGPDTATATIIDDDLGTLT
LGKTTDGKEAGLVSSVFTLTRTGDLSSALTVNYTLAGTATLGSDYNDPSLGQATFAAGAD
KATIILPTTDDIVVDPSETIITTITAPTGYTISGPDTATATIIDDDLGTLTLGKTTDGKE
AGSVSSVFTLTRTGDLSSALTVNYTLAGTATLGSDYNDPSLGQATFVAGSPTATITLPTI
DDIVVDPSETIITKITAPTGYTISGPDTATATIIDDDLGTLTLGKTTDGKEAGSVSSVFT
LTRTGDLSSALTVNYTLAGTATLGSDYNDPSLGQATFAAGADKATIILPTTDDIVVDPSE
TIITTITAPTGYTISGPDTATATIIDDDLGTLTLGKTTDGKEAGLVSSVFTLTRTGDLSS
ALTVNYTLAGTATLGSDYNDPSLGQATFLAGADKATIILPTTDDIVVDPSETIITTITAP
TGYTISGPDTATATIIDDDLGTLTLGKTTDGKEAGSVSSVFTLTRTGDLSSALTVNYTLA
GTATLGSDYNDPSLGQATFAAGADKATIILPTTDDIVVDPSETIITTITAPVGYTISGPD
TATATILDNDGNAANNNLVGTGFADALAGVGGNDTLSGLGGNDTLDGGANNDTYLFDTDL
VLGSDRVIDASGIDTLNFAATTTKTINLNLGSTVAQTVTAGNLTLTLASATAFENVIGGS
LNDNIVGNTLANSLSGGAGNDTLNGGANNDTYLFDTDLVLGSDRVIDASGIDTLNFAATT
TKTINLNLGSTVAQTVTAGNLTLTLASATAFENVIGGSLNDNIVGNTLANSLSGGAGNDN
LTGGLGKDTLTGSTGLDTLTYNSLGESLLSGFDVIQGYSGTGANLERINAPGSIAAITLT
ASKGTATSLTEAAIQLVLTNAAFAANTAAAFTVTGQSGTFIALNNGVAGFQAASDAIIQL
SGYNIAVATPVVVI
Download sequence
Identical sequences B0JT18
449447.MAE_12400 gi|166363981|ref|YP_001656254.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]