SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 449447.MAE_14970 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  449447.MAE_14970
Domain Number 1 Region: 9-336
Classification Level Classification E-value
Superfamily Thiamin diphosphate-binding fold (THDP-binding) 2.85e-115
Family TK-like PP module 0.000000000643
Further Details:      
 
Domain Number 2 Region: 341-531
Classification Level Classification E-value
Superfamily Thiamin diphosphate-binding fold (THDP-binding) 1.99e-65
Family TK-like Pyr module 0.000000263
Further Details:      
 
Domain Number 3 Region: 536-668
Classification Level Classification E-value
Superfamily TK C-terminal domain-like 3.66e-43
Family Transketolase C-terminal domain-like 0.0000324
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) 449447.MAE_14970
Sequence length 668
Comment (Microcystis aeruginosa NIES 843)
Sequence
MVVASQSLEELCINAVRFLAVDAVEKAKSGHPGLPMGAAPMAFVLWDQFLRFNPKNPQWV
NRDRFVLSAGHGCMLQYALMYLTGYDSVPLEEIKQFRQWKSKTPGHPENFVTEGVEVTTG
PLGQGIANGVGLALAEAHLAARFNKPDAKIIDHYTYVILGDGCNMEGISGEACSLAGHWG
LGKLIALYDDNHISIDGSTDIAFTEDVSKRFEAYGWHVQHVENGNTDLDAIANAIAAAKA
VTDKPSMIKITTTIGYGSPNKSNTADVHGAALGATEIELTRKALGWEYEPFVVPDEVLNR
FRQAVDKGATAETDWNKLFNEYQAKYPAEAALFEQLTTGQLPEGWEQALPVYKPEDKALA
SRKHSEICLNALAGVLPGLIGGSADLTHSNYTELEHFGNFQKGSYQERNVHFGVREHAMG
AICNGIALHNTGLIPYGATFLIFTDYMRNSIRLSALSETRVIWVMTHDSIALGEDGPTHQ
PVEHVASLRAIPNLLVMRPGDGTETSGAYKVAVSETKRPTLLALSRQNLPNLAGTSLDGV
AKGAYIITDSEGTPDVILIGTGGELYLCDKAAAVLKEAGIKARVVSMPCWELFEEQSAEY
KESVLPKAVKKRLAVEAGSTMGWHRYITDEGDVLGVDTFGASAPGGVILEKFGFTVNNVV
AKAKALLG
Download sequence
Identical sequences B0JUD1
449447.MAE_14970 gi|166364238|ref|YP_001656511.1| WP_012264879.1.4043

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]