SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 449447.MAE_26640 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  449447.MAE_26640
Domain Number 1 Region: 6-186
Classification Level Classification E-value
Superfamily Thiamin diphosphate-binding fold (THDP-binding) 1.34e-37
Family Pyruvate oxidase and decarboxylase Pyr module 0.0044
Further Details:      
 
Domain Number 2 Region: 390-558
Classification Level Classification E-value
Superfamily Thiamin diphosphate-binding fold (THDP-binding) 6.82e-21
Family Pyruvate oxidase and decarboxylase PP module 0.023
Further Details:      
 
Weak hits

Sequence:  449447.MAE_26640
Domain Number - Region: 226-376
Classification Level Classification E-value
Superfamily DHS-like NAD/FAD-binding domain 0.0203
Family Pyruvate oxidase and decarboxylase, middle domain 0.043
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) 449447.MAE_26640
Sequence length 569
Comment (Microcystis aeruginosa NIES 843)
Sequence
MSIDFRNLNTLWGSILVETLARLGLKIGVVSPGSRSTPLTIALARHPQIEAIPILDERSA
AFFALGLAKQLYQPVVLVCTSGTATANFYPAVIEAKESHVPLLILTADRPPELRHAHAGQ
TIDQVKLYGNYPNWQAEISCPSANIERLRYLRQTIIHAWWRCLDPVPGVVHLNLPFRDPL
APTPDLEINNLEANFDQEAFFSHISRQNIAINHSILQINSLPSKGIIIAGLASPQNPESY
CQAIADLARSQQYPILAEALSPLRNYAGLNPHLITTYDLLLRNPALRTQLTPDVVLQIGE
LPTSKELRTWLEEIDCPRWIIDPHPDNYDPLQGKTGHLRVNIEQLGDLFPDKTDNNREYR
QLWQKFDQQARLTIDRLLAAETKLIEGKIPWLLSQYLPPRTPIFISNSMPVRYAEFFNPP
SDRQIRPYFNRGANGIDGNLSTAIGIAYKNVPSLLLTGDLALLHDTNGFLIKKYFVGSLT
IILINNKGGGIFQMLPIAKFDPPFEEFFATPQNIDFCQLCRTYGIDYHLISDWTDFEQKI
AVLPESGIRLLEISCDRAFNTQWFLSNYV
Download sequence
Identical sequences B0JII8
449447.MAE_26640 WP_012265754.1.4043 gi|166365405|ref|YP_001657678.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]