SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 449447.MAE_28660 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  449447.MAE_28660
Domain Number 1 Region: 55-283
Classification Level Classification E-value
Superfamily beta-Roll 7.85e-33
Family Serralysin-like metalloprotease, C-terminal domain 0.00016
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) 449447.MAE_28660
Sequence length 308
Comment (Microcystis aeruginosa NIES 843)
Sequence
MLIAKVRCSLSNAVNATINPDEAIGQVIITDTLQSSITRTLPNNVENLRLIGSNNINGTG
NAGDNKITGNSGNNILAGANGNDIYCFNASTPLGSDTIQETTTGGIDTLDFTGTNTAVRV
NLGTTAVQTAVTNNLKLTFSANNTIENIISDSGNDRLTGNSLNNTLTGGGGNDQLTGQNG
NDRLIGGFGDDLLTGGNGSDNFIFNSSNLGIDAISDFTSGSDKIVLSKAIFTALQSIIGN
GFSQPAEFASVADDDLVATSSAFIVYSNSSGSIYYNQNGSAAGLGSGSEFANLLTVPTLI
AADFALIN
Download sequence
Identical sequences B0JJP6
449447.MAE_28660 gi|166365607|ref|YP_001657880.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]