SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 449447.MAE_58460 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  449447.MAE_58460
Domain Number 1 Region: 1088-1308
Classification Level Classification E-value
Superfamily beta-Roll 2.01e-24
Family Serralysin-like metalloprotease, C-terminal domain 0.00039
Further Details:      
 
Domain Number 2 Region: 165-553,580-598
Classification Level Classification E-value
Superfamily Pectin lyase-like 1.49e-23
Family Pectate transeliminase 0.048
Further Details:      
 
Domain Number 3 Region: 719-827
Classification Level Classification E-value
Superfamily CalX-like 3.14e-23
Family CalX-beta domain 0.0034
Further Details:      
 
Domain Number 4 Region: 605-716
Classification Level Classification E-value
Superfamily CalX-like 1.7e-18
Family CalX-beta domain 0.0044
Further Details:      
 
Domain Number 5 Region: 927-1088
Classification Level Classification E-value
Superfamily beta-Roll 0.00000000000000256
Family Serralysin-like metalloprotease, C-terminal domain 0.0011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) 449447.MAE_58460
Sequence length 1318
Comment (Microcystis aeruginosa NIES 843)
Sequence
MTSTLLPILPAVDDVLFNFAQSDGFWVNLETAFGTSYDVVKATQLRQQWQSRNFSQLPPI
EVLSDEVLGTANGAYSSSKNKIYLSASFLNTASSATIINVILEEIGHYVDAQINQVDSAG
DEGEYFAALVRGVDLTTQEVARITTENDFANITITGNDVPVEKSAPTILTVNTTADQNDG
NADNGLSLRDAILIANANPNTEYEIHLTGGLTYTLTSNGVNENEGKKGDLDIKSRNNVLY
IGAFNGQKATIDASGLLNSDRVFHVLSGGALSLQNVVVTGGIISSSGAGISVNATGVLDL
YNTTVSGNKALGSSSNGGGIQNRGFVYLRQGSVVSNNIASGSSFQEGGGVDNSGGTLIAI
NSTINNNQGGVYGGGISSVAGSLTLINTTVSGNSAGNGGGITNNGTSMALINTTVSGNNA
SYAGGGIYSSGDTFNLINSTITNNTVVDTQFVGRRGGGGIYSLGTTFFLKNTIVAGNIDN
TTNGFDLLSSGLSGAIFNGNNYNLIGDLTGAKGTIGTGTDIVNSNPGLAPLANYGGLTLT
HALLAGSPAINAGNNSLILVDSEDIDGDGDTTEQIPFDQRGTGFNRIFGGTVDIGAFEEQ
GTIVVISLAVSPASVNEDGTTNLVYTFTRSGVTTNSLTVNYTLGGTATLNTDYTRTGTTN
TVTFAANSSTATVTVDPTADTTVENNETVALTLASGTGYTVGTATAVTGTITNDDFSKLS
INNITVVEGKDNNAILTVTVDNPNSQPITFNYTTAPINATANVDYTSKTGTITIAPNTST
ATITIPILNDNLNEANETFAINLSNPINATLTNNKGIVTISDTLTANVTTTLPANVENLT
LTGTTNINGTGNAANNIITGNSGNNILNGGTGIDTLIGGLGNDTYQVDTTTDTITENANQ
GTDTVQSSVTYTLGNNLENLTLTGTANINGTGNTLNNIITGNSGNNILNGATGIDTLIGG
LGNDTYQVDTTTDTITENANQGTDTVQSSVTYTLGNNLENLTLTGTANINGTGNTLNNII
TGNSGNNILNGATGIDTLIGGLGNDTYQVDTTTDTITENANQGTDTVQSSVTYTLGNNLE
NLTLTGTANINGTGNTLNNIITGNSGNNILNGATGIDTLIGGLGNDTYQVDTTTDTITEN
ANQGTDTVQSSVTYTLGNNLENLTLTGTANINGTGNTLNNIITGNSGKNTLTGSAGNDTL
IGGTGNDTITGGAGGDRFTFKNPNQGIDTITDFLSSQGDKITVSAAGFGGGLAAGVAITA
AQFVLGTTALNASNRFIYNTITGGLFFDGDGTGTLAAIQIATLSSKPTLTASNILVLV
Download sequence
Identical sequences B0JIW0
gi|166368587|ref|YP_001660860.1| WP_012268045.1.4043 449447.MAE_58460

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]