SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 452637.Oter_3383 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  452637.Oter_3383
Domain Number 1 Region: 126-183
Classification Level Classification E-value
Superfamily His-Me finger endonucleases 0.0000000341
Family Intron-encoded homing endonucleases 0.013
Further Details:      
 
Weak hits

Sequence:  452637.Oter_3383
Domain Number - Region: 67-146
Classification Level Classification E-value
Superfamily N-terminal domain of cbl (N-cbl) 0.0275
Family N-terminal domain of cbl (N-cbl) 0.0095
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) 452637.Oter_3383
Sequence length 203
Comment (Opitutus terrae PB90 1)
Sequence
MASSAVRYFERAAGDARDAVAVQARTKIGLAPDRVRALLEASRPLTPEEARRAMVRQVRP
KSCGRTGLPRYAVELMYADYKRLRSLSKTGRLHARTRQSMYQIFQAHGLPLYERRFQRKI
RFAGREFTPGKDGYYRATSGDRRQLHYVIWERANGPVPAGHQVTFKNADKRDFRIENLAC
MPIRDVTLFHHARHTAAKDRAKP
Download sequence
Identical sequences B1ZU98
gi|182415194|ref|YP_001820260.1| 452637.Oter_3383

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]