SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 45351.JGI199995 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  45351.JGI199995
Domain Number 1 Region: 143-237
Classification Level Classification E-value
Superfamily Eukaryotic type KH-domain (KH-domain type I) 2.05e-20
Family Eukaryotic type KH-domain (KH-domain type I) 0.0014
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) 45351.JGI199995
Sequence length 238
Comment (Nematostella vectensis)
Sequence
MADTSECQSDKTVKEEPFQSVKTRKRRKNDKEEEMDTVESRARPSFPPVKAQKLAGGKSE
TRKIPVPSHRYTPLKENWMKIFTPVVEHLKLQIRFNLGSRHVEIRASKETSDIGAVQKAA
DFVQAFILGFEVEDALALIRLDDLFLESFEIADVKPLKGDHLSRAIGRVAGKGGKTKFTI
ENVTKTRIVLAETKIHILGSFQNIKIARTAICNLILGSPPSKVYGNMRAVASRSAERF
Download sequence
Identical sequences A7RP64
jgi|Nemve1|199995|fgenesh1_pg.scaffold_18000119 XP_001638868.1.94760 45351.JGI199995

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]