SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 45351.JGI213744 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  45351.JGI213744
Domain Number 1 Region: 36-208
Classification Level Classification E-value
Superfamily Ankyrin repeat 5.56e-22
Family Ankyrin repeat 0.00062
Further Details:      
 
Domain Number 2 Region: 253-296
Classification Level Classification E-value
Superfamily SOCS box-like 0.0000916
Family SOCS box-like 0.0069
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) 45351.JGI213744
Sequence length 331
Comment (Nematostella vectensis)
Sequence
MGAAISGTSSNVEELSGCLLTLLNKRPTCDEVPSKLEDVRLLLQQGAPVDAKIHPRQRLY
EPDYATTTALQVCCSVGDVSAAKELLRIGADIRLLTKEGTVLHSAVKSKWLGKRFTDMLE
LLLEYWPEIINIKNFQADTPLHVAVMEGYTEYIESLLSHGADLTLLSSSVNVPPCQHSPL
FPIDRALGYAIQIGNLATILTLLQNGDNFMGLCCQQRFAFMKPDFVKLMVEANWEEKKYR
WMYEEDNWSPELIDWIRNPRPLSFLCRQTIRRAVGSKNLKNIACLPLPQSCKDVLIRFGN
YRLKDSFDVTDSIWIRRWKHYHDVSSLKRTD
Download sequence
Identical sequences A7SKN2
45351.JGI213744 jgi|Nemve1|213744|fgenesh1_pg.scaffold_183000030 XP_001647523.1.94760

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]