SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 45351.JGI236828 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  45351.JGI236828
Domain Number 1 Region: 102-191
Classification Level Classification E-value
Superfamily Eukaryotic type KH-domain (KH-domain type I) 6.57e-20
Family Eukaryotic type KH-domain (KH-domain type I) 0.00095
Further Details:      
 
Domain Number 2 Region: 24-96
Classification Level Classification E-value
Superfamily Eukaryotic type KH-domain (KH-domain type I) 1.46e-16
Family Eukaryotic type KH-domain (KH-domain type I) 0.00023
Further Details:      
 
Domain Number 3 Region: 239-316
Classification Level Classification E-value
Superfamily Eukaryotic type KH-domain (KH-domain type I) 1.61e-16
Family Eukaryotic type KH-domain (KH-domain type I) 0.00033
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) 45351.JGI236828
Sequence length 338
Comment (Nematostella vectensis)
Sequence
MSADEEQVASRPAESRPAKGRGHSSNLVLKMIMQGKDIGSIIGKEGSTIKQFRQESNAHI
NISDGSTPERIVSVTGTKDAVVTAFALIGQKLEDELKSNSKSNTTPPVTLRLIVPGSQCG
SIIGKGGAKIKEIREVSGASVVVAGEFLPGSSERAVTLSGTPEALETCIDLLCGVMIEFP
PRGHPMPYTPHKLQQQFGFYGPPQGFGYPGPYGMPHAFPNGFMAGRGPYGGGRKGKGPPP
PQPGPITSHTMTILKGAVGSIIGQKGSYITGIRQMSGASIKIGDSENGDDKREVLITGTA
EAVGLAQFLINARLRQDGKSPVVTDKDKPHNAENGDAE
Download sequence
Identical sequences A7S1C6
XP_001634548.1.94760 45351.JGI236828 jgi|Nemve1|236828|estExt_fgenesh1_kg.C_580003

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]