SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 45351.JGI239529 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  45351.JGI239529
Domain Number 1 Region: 106-168
Classification Level Classification E-value
Superfamily RING/U-box 4.47e-20
Family ZZ domain 0.015
Further Details:      
 
Domain Number 2 Region: 384-426
Classification Level Classification E-value
Superfamily UBA-like 0.000000000000791
Family UBA domain 0.0023
Further Details:      
 
Domain Number 3 Region: 15-93
Classification Level Classification E-value
Superfamily CAD & PB1 domains 0.000000000028
Family PB1 domain 0.013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) 45351.JGI239529
Sequence length 428
Comment (Nematostella vectensis)
Sequence
MSLSVKAYLLQDDGNQEIRRFAVDEGVSTNYDYLVQKVQSVFPNVRGRGIRLYWKDSDEE
LVTFSSDEELVEALGSLNGNVFRLFIKPVGEVPIPPEGSDDSGASNAIHPGVVCDGCNVN
IMGTRFKCVICPDFDLCMKCEAKGLHREHEMLRICTPRAHPHFHGPFANPPPPFGPQHFA
QGFGPWKHGHRGHFWGPGRRCGGPRGHCGKGRGPRCNRHQEKAKESTEQPQPGTSAEEQG
QEVPVGPPFLHNMGEALASFLGPMGVEVHTYADDEQDCCQGKCNCSHKKHGKKYPKDSSS
SSSSSSSSSSSSDSENEKKAHKKGKHGKHKEERDGKTAEATDSLPMDTEHGEGYVLVDKE
NQSENTTEDQGGAAEGTDEAPVDPLEVAIAQMRAMGFEDDSGWLAQLIKSKEYDIGKVLD
AIQFEGKK
Download sequence
Identical sequences A7RN64
jgi|Nemve1|239529|estExt_fgenesh1_pg.C_160036 45351.JGI239529 XP_001639077.1.94760

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]