SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 453591.Igni_0211 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  453591.Igni_0211
Domain Number 1 Region: 64-155
Classification Level Classification E-value
Superfamily Nucleic acid-binding proteins 5.55e-20
Family Cold shock DNA-binding domain-like 0.00015
Further Details:      
 
Domain Number 2 Region: 151-230
Classification Level Classification E-value
Superfamily Eukaryotic type KH-domain (KH-domain type I) 1.33e-16
Family Eukaryotic type KH-domain (KH-domain type I) 0.00012
Further Details:      
 
Domain Number 3 Region: 9-63
Classification Level Classification E-value
Superfamily Ribosomal L27 protein-like 0.0000000011
Family ECR1 N-terminal domain-like 0.0052
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) 453591.Igni_0211
Sequence length 239
Comment (Ignicoccus hospitalis KIN4 I)
Sequence
MNKQSNEVQRKIVMPGDLVVKGNYTINPKSIMYLYKVGDAVYAAVAGMAEITNGTVSLIP
FEGTYIPKPGDLVIGVVENFVVTHWQVDINSPYIGILHVSNLLGRPYNPAKDNLKEYLDI
GDYIIAKVESFDRTKDPILNVQGKGLGRVVEGKIVEIKPSRVPRVIGKKKSMLNVIKGDT
GCEIIVGANGRIWIKCPNKDLEDIVTLAIKLIEREAFATGLTEKVRVLIATEKHERGLL
Download sequence
Identical sequences A8A8Z3
gi|156937006|ref|YP_001434802.1| WP_011998247.1.33635 453591.Igni_0211

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]