SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 453591.Igni_0347 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  453591.Igni_0347
Domain Number 1 Region: 2-363
Classification Level Classification E-value
Superfamily Nucleotidylyl transferase 1.62e-61
Family Class I aminoacyl-tRNA synthetases (RS), catalytic domain 0.0000028
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) 453591.Igni_0347
Sequence length 378
Comment (Ignicoccus hospitalis KIN4 I)
Sequence
MDEKIRLIMREPTEEVLTPELLKEYIEQGVPLKHYIGFEISGFVHLGTGIVTMRKVADLQ
RAGVKTTLFLADYHSWINKKLGGDLDTIKRVALGYFKEALLQSLKAVGGDPESVEVILAS
EFFEKLGIKYFENFLRVSNRLTLARVKRSITIMGRKEGESVNFGQLVYVPMQVADIFSLG
VNLAHGGMDQRKAHVIAIEVGPKEFGYKPVALHHHLLLGLHIDEETREKLLKAKREGDRE
AFEEGIVEIKMSKSVPQSAIFVHDSPEEIKRKLKRAYCPIGEVEMNPVLEIVKYVVFPWL
EDLGRSFEVVNKKTGERKEYKSYQEVERDFAAKALHPLDLKLAVAEYLVEMLKPVREYFV
EGPGKKYLEEMKEIQITR
Download sequence
Identical sequences A8A9C8
453591.Igni_0347 gi|156937141|ref|YP_001434937.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]