SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 453591.Igni_1210 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  453591.Igni_1210
Domain Number - Region: 154-237
Classification Level Classification E-value
Superfamily Prefoldin 0.000314
Family Prefoldin 0.017
Further Details:      
 
Domain Number - Region: 105-174
Classification Level Classification E-value
Superfamily occludin/ELL-like 0.0209
Family Occludin/ELL domain 0.014
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) 453591.Igni_1210
Sequence length 294
Comment (Ignicoccus hospitalis KIN4 I)
Sequence
MRSNALEVKLDEINAEIEELRKERAELITKIKELRAQRKALIEKKRAEVERLRELRAERA
KLVEELRQLKESRREAKQKLNQVLEELKKLKSIVEQGKRGPSPNSLRRRIQQLEWRLQTN
VLTREEEEEIVREIARLEEALERLTKVEEAKKKLIELRAELARLRLLIKSYNENINEISN
KISEVDGRISNVREEVDRLNGKIDELKAKIDEYSKKVEEIDLKLSQLREEKRKLVEEIKK
GEAMAAKNKGEALLSELAKRAKEKMERGEPLTFEELQALMMVEGDGQENIGSNG
Download sequence
Identical sequences A8ABT4
WP_012123350.1.33635 453591.Igni_1210 gi|156937997|ref|YP_001435793.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]