SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 453591.Igni_1260 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  453591.Igni_1260
Domain Number 1 Region: 11-174,234-339
Classification Level Classification E-value
Superfamily Pseudouridine synthase 2.45e-35
Family tRNA pseudouridine synthase TruD 0.01
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) 453591.Igni_1260
Sequence length 345
Comment (Ignicoccus hospitalis KIN4 I)
Sequence
MRRPHPIDYYVGMTKYFLNLEACEGRVLRPKGFRVIELSEPSPGPSYVYLLLKEGIDTIH
ALREIRRRLGGKWYHLGLKDANGVTLQLLSSDVVSEGLQLRLRKGCLVLTPLGRGSINKA
RMWGNAFVIDLQCSKPHSLEGKVKVPGYFSYQRFGTARPVSHVVGKMILLERWEEAVEAL
LGEPTPWESEAARRVRLEYYSEGPRAYLRAPKFMDVERRVAFELLRGSSPKRALKKSGLT
ELFLHAYQSYLYNKRLSEFDDPCEGPEALPGPGAEGYEELLEEEGVTLELFKKFGLRAAP
RRPCYETYVKSFARGDGRVTLIFKLPRGYYATSLLREIVRDPFAV
Download sequence
Identical sequences A8ABY4
453591.Igni_1260 gi|156938047|ref|YP_001435843.1| WP_012123400.1.33635

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]