SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 4558.Sb01g021605.1 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  4558.Sb01g021605.1
Domain Number - Region: 36-72
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0309
Family EGF-type module 0.059
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) 4558.Sb01g021605.1
Sequence length 188
Comment (Sorghum bicolor)
Sequence
MVVVASSRSPGGVVLLLAAALLLVCTATGSVASDSSTICDTAKCGKGTCSEVPGIIPLLT
SSYKCTCDPGWEQPTLLNLTAAPFAPCIIPNCTFDSSCYNFSFLFTPPNGISFTDPCLVV
NCGSGDCKKGDGLSYTCECHPGSSNLLNLNMLPCMKNCSFGADCSKLGINPQGAPPPPPP
PSRGAPPP
Download sequence
Identical sequences 4558.Sb01g021605.1 jgi|Sorbi1|5029142|Sb01g021605

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]