SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 4558.Sb02g005460.1 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  4558.Sb02g005460.1
Domain Number 1 Region: 57-166,194-334,460-611
Classification Level Classification E-value
Superfamily Subtilisin-like 1.23e-69
Family Subtilases 0.0051
Further Details:      
 
Weak hits

Sequence:  4558.Sb02g005460.1
Domain Number - Region: 385-450
Classification Level Classification E-value
Superfamily PA domain 0.0445
Family PA domain 0.016
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) 4558.Sb02g005460.1
Sequence length 744
Comment (Sorghum bicolor)
Sequence
MSTVFKALSLCVLAVCCFFLGSSHASEVSSHGDEGPQQVYIVYMGHQHEPSELLAGGFSA
AKAAHHGLLNKVLDDGSDAMDRIIYSYTRSINGFAARLTEEEKRKLSSKEGVVSVFPSRT
YHLQTTRSWDFLGFPETAPRSLPTEAEVIVGMIDTGVWPDSPSFSDEGFGPPPSRWKGVC
HNFTCNNKIIGARAYRRGYTTLSAVDTAGHGTHTASTVGGRVVEGVDLGGLAAGSARGAV
PGARLAVYKVCWDDFCRSEDMLAAFDDAVADGVDLISFSIGGKLPAPYFEDAPAIGAFHA
MRRRVLTSAAAGNSALDGGRVDNVAPWMLSVAASSTDRRLVGKLVLGNGKTIVGASVNIF
PDLKKAPLVLPMNINGSCKPELLAGQSYRGKILLCASGSDGTGPLAAGAAGAVIVSGAHD
VAFLLPLPALTISTDQFTKIMAYFNKTRNPVGTIRSTETAFDSKAPIVASFSSRGPNLIS
PGILKPDLSAPGIDILAAWTPLSPVSGNLKDNRFAPYSIISGTSMACPHATGVAAYIKSF
HPDWSPAMIMSALITTATPMDPSRNPGGGELVYGAGQLNPSRAHDPGLVYDAREDDYVRM
LCAEGYNSTQLRAVTGSDATACHAAATSGSGSAADLNYPTMAHLAKPGKNFTVHFPRTVT
NVGAPGSVYTAKIAGLGPYIRVAVKPRRLAFSRLLQKVSFTVTVSGALPDANEFVSAAVV
WSDGVRQVRSPIIVHTVDVEYTPK
Download sequence
Identical sequences C5XBY3
4558.Sb02g005460.1 jgi|Sorbi1|5032744|Sb02g005460

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]