SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 4558.Sb02g034775.1 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  4558.Sb02g034775.1
Domain Number 1 Region: 320-564
Classification Level Classification E-value
Superfamily Calponin-homology domain, CH-domain 4.54e-31
Family Calponin-homology domain, CH-domain 0.0012
Further Details:      
 
Domain Number 2 Region: 952-1066
Classification Level Classification E-value
Superfamily ARM repeat 0.000023
Family Armadillo repeat 0.044
Further Details:      
 
Weak hits

Sequence:  4558.Sb02g034775.1
Domain Number - Region: 840-923
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 0.000345
Family Motor proteins 0.019
Further Details:      
 
Domain Number - Region: 786-837
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 0.0372
Family Motor proteins 0.044
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) 4558.Sb02g034775.1
Sequence length 1102
Comment (Sorghum bicolor)
Sequence
MSRGEPAASPFRDLSNLRTPRPNPNDVPPSPQFFTASKTPLHAPTPTPRGRRRPGNGAPT
LTPLGRRLRAFEVDQSRSARRAESGRERALRAFAASASSWLSLLLRDPSACGCSPAVTGS
AAAAQPCAAGKRGALDGERPRGGRSPKRHRGAGDRCGERRKEMTPAMVAALREYLREACS
LEDVTERMENYMSKGACEEVLFMMFQICKNIDEGRLKMKAQCPLVTDLRLKEKATRIFMS
YNPYWLRIGLHIVLGSDSLLQTGQGKWDKEVHFLKLILEKYMFSQMMTAKSSGHKNVVEK
HHVQGYSEVLGNIILKRIFLLVVALDRAKIESALPLEAGIDGLDGGSPLLFSHQGQIKSS
RQIIQESLRETMHGEGDILIHLTTMGYKLNYQQPALSEYDFTMRSLFEDLQDGIILCRVV
QLLLADASIISKVIAPSDTNKKRLSNCSTAIQYIKQAQVPLSDSDGVTISAEDIAAGDKE
LILSLLWNMFIHMQLPLLASTASLARELTRLNVHVMEQQMSENKPHMGLLYNWVQAICSK
YGMTVENSSQFDRRALNCLINYYLNIDMLPPKVLETLTGCRKELFTCHQLDTITDDITSC
PSSKMGKDIPASDILADGVLFDEKSTILLLAFLSSHLTNDERLGHLKNLINMRLDYKCAE
TKVSARRRSRGKIDTKYHPSQTDEKDGACTNQATPLQLSGSQRNSITSTTQLWKSGHESI
PPPKSPLDMFESNCQSCVVETSNAVSISMLVSVDDMECSSNISSQEFLKPVSTCIYFPVC
KELVAAQRIQNAYRRYLNNRNRITAAIKIQSQWRCYSVRKGFTKQVQAIVGIQTSIRTSV
ISIQSFVRGCLARKKLNQTFCCINIIQRWWRKVLFIKLRKQAVLVIQAHFRGWIARQVAS
RTRKSITTIQSYVKAYLVRKASKQAVAQINLPVICSRAKRLYVLSPTGSATEYSKKCCET
LVTAGAVDILLKQIHLLNRGIADQEVLKQVFLTLRNIARCANLRQVLSSTPEFTKIIFQE
LLRNKADVFFIASDILKSLCESKEGHETVQALSHHIKRLHNLVQDLEKKVELDKRNGRTG
AAKANNLRRLREATTLYHLLTH
Download sequence
Identical sequences 4558.Sb02g034775.1 jgi|Sorbi1|5034408|Sb02g034775

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]