SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 4558.Sb02g043010.1 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  4558.Sb02g043010.1
Domain Number 1 Region: 101-173
Classification Level Classification E-value
Superfamily PA domain 0.00000288
Family PA domain 0.015
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) 4558.Sb02g043010.1
Sequence length 636
Comment (Sorghum bicolor)
Sequence
METTTAARRRRRLLLLLVLLALAAHRAAARFVVEKNSLRVTSPAALRGVYECAIGNFGMP
QYGGTMHGVVVYPKVDAKACRPFDASGLSFKPKSGGLPVFLLVDRGDCYFTTKGWNAQNA
GAAAVLVADDKVEPLITMDSPESSGTEHIENITIPSALVTKRFGDDLRKALQNGEMVNVL
LDWRESLPHPDERVEYEFWTNSNDECGAKCDMQMNFVRSFRGIAQALEKRGYTQFTPHYI
TWYCPEAFILSKQCKSQCINHGRYCAPDPEQDFSIGYDGKDVVVQNLIQICVFRVANETR
RPWMWWDYVHDFAVRCPMKEKKYTRECAHGVINSLGLDIEKINKCVGDPDADKENPVLKA
EQDAQIGHGSRGDVTILPTLVVNNRQYRGKLEKRSVLKAVCSGFEETTEPDVCLREDIET
NECLENNGGCWLDKATNVSACKDTFRGRVCECPTVNGVKFIGDGYSHCEASGLGRCQINN
GGCWNETRNGKTVSACSNQEAKGCKCPSGFRGDGMNSCEDVDECKEKLFCQCKDCACENT
WGSYECSCGGSNSLYIREHDTCISKQSSSSLGWGFLWVIFIGLALAGAGAYAVYKYRLRS
YMDSEIRAIMAQYMPLESQEMPNQHRSVVPVDHADI
Download sequence
Identical sequences C5X5M2
jgi|Sorbi1|5052249|Sb02g043010 XP_002463394.1.57931 4558.Sb02g043010.1

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]