SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 4558.Sb03g046410.1 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  4558.Sb03g046410.1
Domain Number 1 Region: 99-188,285-307
Classification Level Classification E-value
Superfamily alpha-D-mannose-specific plant lectins 3.01e-24
Family alpha-D-mannose-specific plant lectins 0.0033
Further Details:      
 
Weak hits

Sequence:  4558.Sb03g046410.1
Domain Number - Region: 143-279
Classification Level Classification E-value
Superfamily Calcium-dependent phosphotriesterase 0.0654
Family All0351-like 0.085
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) 4558.Sb03g046410.1
Sequence length 463
Comment (Sorghum bicolor)
Sequence
MALALSLSLSLSLLLVGGVVVRAQPFDYPTAKPSTRWANTDASLPHHVTYADGSVARAAL
LRLNPAGYGPSYAFGFFCTNHQAPPCAEFLLAVAVVYCNSGGLMTSVVAGIPQVVWSANR
GQPVGEGASAELTAAGDLVLRSATGAVVWSSGTAGRSVAAMAVTRDGNLVLLDARNATVW
QSFDHPTDALLVGQSLRAGARLVANSSAANWSASRLYLTVADDSLSAYVDAKPPQRYYHL
GFSKAAGAYATYANGSLAVFDPAAAPAASTPPLATIQLPEVGAGTVQYMRLEHDGHLRLY
EWNPAGWAPVFDVLRLFPDDCAFPTVCGAYGVCTDMQCSCPDAANFRAVDFRRPNRGCVP
TAPVACGGPPARLVSLPGLAYFNDPATSLKALERVSDAACRKACLDECRCAAAQFVYGAD
AGDGFCYLQSEVLSMETSRPEVVHYNSTMHLKVRATRRPSAGF
Download sequence
Identical sequences C5XIK1
jgi|Sorbi1|5054415|Sb03g046410 XP_002456960.1.57931 4558.Sb03g046410.1

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]