SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 4558.Sb04g006740.1 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  4558.Sb04g006740.1
Domain Number 1 Region: 14-206,320-447
Classification Level Classification E-value
Superfamily Subtilisin-like 7.86e-61
Family Subtilases 0.01
Further Details:      
 
Domain Number 2 Region: 225-298
Classification Level Classification E-value
Superfamily PA domain 0.00000484
Family PA domain 0.014
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) 4558.Sb04g006740.1
Sequence length 590
Comment (Sorghum bicolor)
Sequence
MGLDFILSLFFAFFLNGYAAASGVLNASTNTPRDPGGHGTHTLSTAGGSPVPGASVFGFG
NDTASGGSPRARVAAYRVCYPPVNGSECFDADILAAFDAAIHDGVHVLSLSLGGDPSDYF
DDGIAIGAFHAVRRGISVVCSAGNSGPALGTASNLAPWLFTSGASTMDREFPSYIVYDRT
KKAKGQSLSITTLPEKTSYPLIDSVKAAAANASTKDAQLCMIGALDPAKVKGKIVVCLRG
INPRVAKGEAVKQAGGVGMVLANDVTTGNEIIADAHVLPATQIKYSDGLHLYSYLNSTKN
PAGFITKPATVLGTKPAPFMAAFSSQGPNTITPEILKPDITAPGVSVIAAWTRANSPTDL
AFDPRRVAFNSQSGTSMSCPHVSGVVGLLRTVHPQWSPAAIKSAIMTTAIEMDNKGELIL
NSSSRSSSPFGYGAGHIYPTRALNPGLVYDLGDKDYLDFLCALKYNATVMAMFNGAPYTC
PTGEAPHRISDLNYPSITVVNVTSAGATARRRVKNVAKPSTYRAFVVEPAGVSVVVNPSV
LKFSAKGEEKGFEVQFKVKDAALAKGYSFGALAWTNGVHFVRSPLVVKAA
Download sequence
Identical sequences jgi|Sorbi1|5054855|Sb04g006740 4558.Sb04g006740.1

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]