SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 4558.Sb04g007950.1 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  4558.Sb04g007950.1
Domain Number 1 Region: 230-314
Classification Level Classification E-value
Superfamily Eukaryotic type KH-domain (KH-domain type I) 2.19e-18
Family Eukaryotic type KH-domain (KH-domain type I) 0.00079
Further Details:      
 
Domain Number 2 Region: 144-217
Classification Level Classification E-value
Superfamily Eukaryotic type KH-domain (KH-domain type I) 3.51e-16
Family Eukaryotic type KH-domain (KH-domain type I) 0.00076
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) 4558.Sb04g007950.1
Sequence length 688
Comment (Sorghum bicolor)
Sequence
MADDHYSSKRKYDDPSPPPRRTGFSSGPPPASPPAGGAPSYNSVPPPPDEIQLAKQRAQE
IAARIFNAAEAKRPRVDNGDDDVGGYGGGGTLGGSGGGGGGRIGGGGLGFSSSAGGGYGA
SIPPLSSQSSAPQYSSYGGYQGTSKKIEIPNGRVGVIIGKAGETIRYIQLQSGAKIQVTR
DHEAEPGALTRPVELSGNPDQISKAEQLIKEVLAEADAGSSGGGSGRKYNAPQPGGETFQ
MKIANNKVGLVIGKGGETIKSMQQKTGARIQVIPLHLPAGDTSTERTVHIDGTPEQIESA
KQLVIEVTSENRARNPMSGGYSQQGYRPPRPQSNWGPPSAPPQQPGYGYMQPGAYPGAPP
QYGAPQQPYGSYPPTSGGYQTGWDQSQNQQSHTTPPGTGYDYYSQQQQPQQQQSAPGTAA
STDATSYNYGQPSTYASQGYDSTYTQQSGGQQAYGHDGYSGYQTQGQQQGYSQQTGYDQQ
GYGASAYGSAANSTQDGSAASYGGPGGASQASPGQQSSTPAASHPGYASQPPTSAAASYP
TQGSAPSGYGAPPPQSGYGTQPPGYGQGAYGQPSPQGQKPPASSPYGQAPPPGSAQGGYG
QYGYSQPAYGAPPAYPGAPHSSHPGYGQQQSYGDAYGSGNYGQPPAYSTEATAAAASQDH
SAAPAAAPATTAAPAPDNSGGAQTSAET
Download sequence
Identical sequences C5XYG2
XP_002451801.1.57931 4558.Sb04g007950.1 jgi|Sorbi1|5054916|Sb04g007950

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]