SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 4558.Sb04g010190.1 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  4558.Sb04g010190.1
Domain Number 1 Region: 9-105
Classification Level Classification E-value
Superfamily Calcium-dependent phosphotriesterase 0.000000000262
Family SGL-like 0.029
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) 4558.Sb04g010190.1
Sequence length 132
Comment (Sorghum bicolor)
Sequence
MKVRSDDGEAQVGQANGSAVFHFVNGLDGDQAMGDVYITDSNATYPRRFNTETMITVLKA
DLPYPNDVAVSSDRMHVVVAHMVPCQAFRYWLKGPKTGQYEVALNQEKARLDAVVAPPVK
HLVGVRPAQCRW
Download sequence
Identical sequences 4558.Sb04g010190.1 jgi|Sorbi1|5038002|Sb04g010190

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]