SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 4558.Sb06g016350.1 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  4558.Sb06g016350.1
Domain Number 1 Region: 410-698
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 2.43e-74
Family Protein kinases, catalytic subunit 0.00023
Further Details:      
 
Weak hits

Sequence:  4558.Sb06g016350.1
Domain Number - Region: 293-341
Classification Level Classification E-value
Superfamily Hairpin loop containing domain-like 0.0153
Family Pan module (APPLE domain) 0.021
Further Details:      
 
Domain Number - Region: 79-109
Classification Level Classification E-value
Superfamily alpha-D-mannose-specific plant lectins 0.0655
Family alpha-D-mannose-specific plant lectins 0.043
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) 4558.Sb06g016350.1
Sequence length 759
Comment (Sorghum bicolor)
Sequence
MQLLVVLCEFLLSLHAPSCSAATDTLSRGGSLAGDERLVSSNGKFALGFFQTNNSNSSTN
TTSNSYLGIWFHKVPKLTPSFDYPTDTLLPGAKLGRNKVTGLNRRFVSRRNLNDQAPGVY
SIGLAPGLDESMRLSWKSSTEYWSSGEWNGNGGYFNAIPEMSDPAYCNYMFVNSDQEFYF
SYTLVNESTIFQVVLDVSGQWKVRVWGWDRNDWITFSYSPRSRCDVYAVCGAFTVCSNSA
NPLCSCMKGFSVRSPEDWELEDRTGGCIRNTPLDCNDSNKHTSMSKKFYPMPFSRLPSNG
IGIQNATSAKSCEGFCLSNCSCTAYSYGQGGCSVWHDDLTNVAADDSGEILYLRLAAKEV
QSGKNHKHGMIISVSVAAGVSTLTLAFIFLIVIWRSSKRSSHRVDNDQGGIGIIAFRYID
IKRATNNFWEKLGTGGFGSVFKGCLSGSVAIAVKRLDGAHQGEKQFRSEVSSIGIIQHVN
LVKLVGFCCEGDRRLLVYEHMPNRSLDVHLFESHGTVLGWNIRYQIALGVARGLAYLHHS
CRDCIIHCDIKPQNILLDASFIPKIADFGMAKFLGRDFSCVLTTMRGTIGYLAPEWISGT
AITSKVDVYSYGMVLLEIISGRRNAGKEAFADDDHAKCFPVQVVDKLLNGGIGSLVDANL
DGNVNLYDVERVCKVACWCIQDNEFDRPTMVEVVQFLEGLSEPDMPPMPRLLHAFRIMNL
IALQSVVIVLGSKGQFRSKDFYRKIKRNKNAGTRVEHSV
Download sequence
Identical sequences jgi|Sorbi1|5041787|Sb06g016350 4558.Sb06g016350.1

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]