SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 4558.Sb06g020770.1 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  4558.Sb06g020770.1
Domain Number 1 Region: 101-180
Classification Level Classification E-value
Superfamily PA domain 0.000000157
Family PA domain 0.0099
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) 4558.Sb06g020770.1
Sequence length 534
Comment (Sorghum bicolor)
Sequence
MATDHRVSLLPFAAALLVLLLAGGAAADDASSSDDAGTSRTPGCSNKFQLVKVKNWVNGT
EGTTVVGLSAKFGAPLPRDIHEAKKSFAVLANPIDCCSNLTSKLTSSVALATRGECAFTE
KANTAQAGGATGLLVINDNEELYKMVCGENDTSINVTIPVVMIPQSAGKMLKNFLHHGAS
VEVQLYSPNRPTVDLSACFLWIMAVGTIVCASLWTEFVTCEQVDERYNQLTRKDGPDTGT
NYREDKEIFEISAKGAIVFIIVASVFLLLLFYFMSSWFVWVLIVLFCIGGIEGMHVCLVT
LLARIFNDCGRKTVQLPFLGEILILSVGIVPFCVVFAILWAVYRHASFAWIGQDVLGICL
MITVLQMARLPNIKVASALLSAAFVYDVFWVFISPLIFNESVMIAVARGDNTGESIPMLL
RIPRFFDPWGGYDMIGFGDIIFPGLLVAFSYRFDRATRKGVLNGYFLWLIVGYAVGLFIT
YLALFLMDGQGQPALLYLVPCTLGVIVILGWLRGELHELWNYGKSRAENLVNEP
Download sequence
Identical sequences A0A1Z5RE08
XP_002446699.1.57931 4558.Sb06g020770.1 jgi|Sorbi1|5057414|Sb06g020770

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]