SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 4558.Sb06g030970.1 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  4558.Sb06g030970.1
Domain Number 1 Region: 373-667
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 6.2e-75
Family Protein kinases, catalytic subunit 0.00014
Further Details:      
 
Domain Number 2 Region: 341-368
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000595
Family EGF-type module 0.005
Further Details:      
 
Weak hits

Sequence:  4558.Sb06g030970.1
Domain Number - Region: 312-350
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0185
Family EGF-type module 0.054
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) 4558.Sb06g030970.1
Sequence length 720
Comment (Sorghum bicolor)
Sequence
MELLSSSRSTSTEAKRIVVVSLVFLLFTVATAVAAAAPVALPGCPETCGNITVPYPFGTR
HGCFREGFNLTCDETPGRPPRLLVGDGGVEVVGISLADGTVRIHTKMLGVSLPVPGNSSS
IRFNGSWSAGVMDTAGRLFVSTTHNRFVAMGCNFLATLVVHGGDDDPASGGGKGNYVSVC
AALCADDGFELLGDTSCSGVGCCQTPIAASALELSYGVRLSELAVQSSASSTSSLGALFI
AEQEWFVRNATILQLDYSGEPQRTIDSWAVPTVLEWSLQYMGHDSDMFFGSDDPNSIGGI
RCISLNSTMVEDGVAGSNVGRARCNCSKGFEGNPYIANGCQDIDECQQPDLYPCHGICTN
LPGTYRCSSKKRISSLPDIAERLKIFSLEELEQATNNFDQNRILGGGGHGTVYKGILSDQ
RVVAIKKSKIIVQKEIDQFINEVVILSQTNHRNVLKLFGCCLETEVPLLVYEFISNGTLS
YHLHSQSESPLSWKDRLRIALETARAIAYLHSAASVSVFHRDIKSANILLTDILTAKLSD
FGASRSISIDETGVLTAIQGTHGYLDPEYYYTSRLTEKSDVYSFGVILAELLTRVKPVFS
SHSSEGASLASHFVSLIRDNRLSDILDSQIVEEGGTEDAKEVARLAMACLSLKGEERPTM
RQVETTLEDVQNSKVHHNSRVPRVNQNIPEAESYSRNKESEGTRLFSLEKEFIQSSEIPR
Download sequence
Identical sequences 4558.Sb06g030970.1 jgi|Sorbi1|5058017|Sb06g030970

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]