SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 4558.Sb09g023490.1 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  4558.Sb09g023490.1
Domain Number 1 Region: 66-161,193-225
Classification Level Classification E-value
Superfamily alpha-D-mannose-specific plant lectins 4.45e-27
Family alpha-D-mannose-specific plant lectins 0.0028
Further Details:      
 
Domain Number 2 Region: 389-471
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 0.0000000168
Family Protein kinases, catalytic subunit 0.0085
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) 4558.Sb09g023490.1
Sequence length 513
Comment (Sorghum bicolor)
Sequence
MHPAFFLLVHLLYSMHAPACSATTDCISAGEALIGDAKLVSSNGRYALGFFHPGSKSSIR
HTPKHWYLGIWFYKVSQLTPIWVANRESPVIGHQRMTKLAIFEDGNLAIFNQATKSVVWS
THASIMAKNSTAVLLDNGNLVSKDATNSSNILWQSFDYPTDIVSPGAKFGIDKTTGLNRR
VVSKRSMIDPSPGRYCQELDPTSAPQFVFKLCNTSIVYWSTGEWNDQYLNAMPEMSGRTL
FNYKFINNNKEEYFQSILLEKDLISISILDISSQNKLLIWLEDKQEWTTIYTQPKDLCGI
YATCGPFTICNSNAPLPCDYMRGFSVSGDGCSLWYDDLLNIRSYTNGTTDDGGILYLRIA
AKDAYNWRNSANGIIAFRYIDLQNATKKFSGRIGSGGFGSVFKGLLTDSTTIAVKRLDGV
RQGEKQFRAEEGNLAGYLAPEWMGGVAITSKVDVYSYGMLLIDIILGRRNTCKGNTSGDV
HVACFPVEVASKLLNGDIGSLLDVQLSGHANLG
Download sequence
Identical sequences 4558.Sb09g023490.1 jgi|Sorbi1|5046722|Sb09g023490

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]