SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 4558.Sb10g004530.1 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  4558.Sb10g004530.1
Domain Number 1 Region: 490-780
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 4.05e-70
Family Protein kinases, catalytic subunit 0.00032
Further Details:      
 
Domain Number 2 Region: 64-208
Classification Level Classification E-value
Superfamily alpha-D-mannose-specific plant lectins 1.57e-26
Family alpha-D-mannose-specific plant lectins 0.0018
Further Details:      
 
Domain Number 3 Region: 335-384
Classification Level Classification E-value
Superfamily Hairpin loop containing domain-like 0.00000785
Family Anti-platelet protein 0.046
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) 4558.Sb10g004530.1
Sequence length 787
Comment (Sorghum bicolor)
Sequence
MRDLCIFTTFVSFLISLSSVSVANDQSYLARGSSISTQDVTTAILVSPNGAFTCGFYKVA
TNAFTFSIWFSWASGKTVSWTANRDAPVNGRGSRLIFRKNGGLILVDYNGMVIWSTNTTA
SRSDRAMLLNSGNLVVMDTDGRHLWRSFDSPTDTLLPLQPMTRNTKLVSASARGLLYSGF
YAFYFASNNILTLIYNGPETSSIYWPDPFYMPWDNGRTTYNSTRYGVLDQTGRFVASDQL
EFEASDLGDEMMRRLTLDYDGNLRLYSLNITTGSWSVSWMAFPRMCNIHGLCGANSLCKY
RLELESCSCLEGFEMIEPSDWSKGCRRKTNTMPFSFRKLPGTDLWGYDLNYSELAPWWMC
RDMCLNNTNCQAFGYRKGTGECYPKAFLFNGRNFADPYNDIYLKTPKAVWSSPELAPGPI
HICKVTEKEAYPSSQMFAADHSSFKFGYFLSSALTLLVIEVTLIIVGCWVVNKWERRPET
MDEGYMIISSQFRRFSYKELERATKCFQEELGSGTSGAVYKGVLDDGREVAVKKLSNMMQ
GEQEFRSELSVIGRIYHMNLVRIWGFCAEQTHKLLVSEFVENGSLDRFLFDYQDLTYVLQ
WSQRYNIALGVAKGLAYLHHEWIVHCDVEPENILLDKEFEPKIADFGLVKVLSRGAGAQM
LSRVHGTRGYIAPEWSLNLPITGKADVYSYGVVLLELVKGVRVSSWVIEGEEVVEMSIRC
SAEILKEKLATQDLSWLLEFVDCRLDGEFNYLQAATMLKIAVSCVEEERSKRPSMDHILK
TLLSLVE
Download sequence
Identical sequences A0A194YHF9
XP_002437895.1.57931 4558.Sb10g004530.1 jgi|Sorbi1|5030942|Sb10g004530

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]