SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 457570.Nther_1537 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  457570.Nther_1537
Domain Number 1 Region: 112-163,358-565
Classification Level Classification E-value
Superfamily Zn-dependent exopeptidases 9.84e-45
Family Bacterial dinuclear zinc exopeptidases 0.0028
Further Details:      
 
Domain Number 2 Region: 217-295
Classification Level Classification E-value
Superfamily PA domain 0.0000262
Family PA domain 0.011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) 457570.Nther_1537
Sequence length 571
Comment (Natranaerobius thermophilus JW NM WN LF)
Sequence
MRFTVESSLSITKLFFILLIAVLITVKLTGCGDHGYMVFLNLEPEEAGEVSGSGTYEQGE
EITVSVDTGESWEFIGWFEDGEKVSKEQEYTFSVTESRNLVAEMKPGEGEVIQGYIEDLL
EIGPRPPGSEAEKEAALFLKDVYRDLGYDEEGYELELQEFKLSEQTGFEDLKGPENMKLA
DISVMDGEEHFGNVSAELADQSWTYEKYHDTVWQAMTSPHGETASVEGEMYYSGTGMEEG
DFPEEVDGNIALIKVDDTEVEWEFNEDLNLRTFEISEQQIENAKEAGAEAVIFTFLDDEH
HQGNTEAQTMVPLIQDKEGKEKEVNIPILGASSIHGQWLQEMEKEHANPPELEISSYKNI
DLKSYNVVATKKSDKEDAPIITVTAHLDSVPGSPGASDNASGTTTLLKLAESLKNKDLDA
ELRFANLGAEEVGLFGAYHYVEQLSEEELENHYNINPDMIGTSYPKNDELFITSLDQSEN
EVTNSLLEGQEILDYDVATFDAQVNINSDHVAFDDKGIPAVCLVWMGERGLEPVYHTPLD
TVEDNISAKRLNLAYDIIKEGIIQLDERIQD
Download sequence
Identical sequences B2A413
457570.Nther_1537 gi|188586158|ref|YP_001917703.1| WP_012447985.1.10671

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]