SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 467705.SGO_1814 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  467705.SGO_1814
Domain Number 1 Region: 247-496
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 0.000000000000025
Family Shikimate kinase (AroK) 0.085
Further Details:      
 
Domain Number 2 Region: 826-962
Classification Level Classification E-value
Superfamily TPR-like 0.0000000000326
Family Tetratricopeptide repeat (TPR) 0.018
Further Details:      
 
Domain Number 3 Region: 109-236
Classification Level Classification E-value
Superfamily TPR-like 0.0000000000784
Family Tetratricopeptide repeat (TPR) 0.09
Further Details:      
 
Domain Number 4 Region: 705-739,774-859
Classification Level Classification E-value
Superfamily TPR-like 0.0000522
Family Tetratricopeptide repeat (TPR) 0.036
Further Details:      
 
Weak hits

Sequence:  467705.SGO_1814
Domain Number - Region: 9-79
Classification Level Classification E-value
Superfamily C-terminal effector domain of the bipartite response regulators 0.015
Family PhoB-like 0.023
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) 467705.SGO_1814
Sequence length 1013
Comment (Streptococcus gordonii Challis substr CH1)
Sequence
MNKKLLSLKLLGSPSVFLDQEEVFFPFAKISALIYYLHINGAVNREEIAGILWENKDNQS
AKKNLRNTIYQANKLLGGDWIIAPNRTVLSLNPNFKIESDVETFIAQPEEHLSLYQGDFL
QGFYLKDSEAFDYWVSKMRNQYEQLYVQACYHQLEKGKDQLNLEDAEQNLRRLISMDEFD
EKNYHLLMKFYRDNDRPGKVIETYYKLVNLLDKELGISPNESIQQLYHEVLAKDRSERKT
KQFLRNTDHFFGRVSEIQRLESYFSKILGEQEARALVLVGGTGIGKRTVTRQVLANQTKY
FQIVMAECFKEEMKSELQPWRGLLDGLGDLVIQHQILTISQWQVILESYFPILTGGISGA
ELDADKLAQFVVDILQKISKKKALVILIEDCHWMDAASTAVLEQVMNHMYDYPVAFVLTK
HLSTPSYLEHFFSHLLVRDKIDFIELQPLNFQDSVAYLQAQKGIVALSEEKVKDIYRVSQ
GIPFFLSEYAEQLLRGEKFQPLTPAIKAKLSLKLDHLSSGEEELLDYLACFREPASLSFL
TKLLALPVEDLVEIIEALRQKRLLIEVEEEDRLVVNFSQELLQIYAYERLSIAKRRMLHH
QIAQSMEECLGDPLYHSQLLNEIAYHYKMSKQPIKSLEYELHYLEATLQFHHELFPIYSR
EFGFIEKTEDNNQAAVLEQFDRIRQEIKDLESKHQNHKDFQLLVLRFLYLEGRYAIRTGN
YQQGMDNIQQVIASAKELQQMEFLLEGYRQMIYYCIQTENIPEMRYYTERALDASVQANN
HEAIAVNLRLKGLYHLMIGDEEQSLHHLYQSIDCFSLTDSLRSKYSIQIAAALDYLAEIE
QIRGNFTTALAHQKEAIDLTENKIAEPSIFAFYIGLGMTYYQLKDYEQAEAILLKAKKAM
ESLSFPWKETQLEVYLGLISCEKGDYQPVLDLLRKKEELISRYGNPRDKGLIYYLMAVIK
YQLQVGDLKESSFAEILTRDFDYYYDTAKSHLNFYRDRHQLKELENLRLRLSQ
Download sequence
Identical sequences A8AZ73
gi|157149734|ref|YP_001451083.1| 467705.SGO_1814 WP_012130848.1.24227 WP_012130848.1.30359 WP_012130848.1.42171 WP_012130848.1.45496 WP_012130848.1.73367

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]