SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 471223.GWCH70_3082 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  471223.GWCH70_3082
Domain Number 1 Region: 261-371
Classification Level Classification E-value
Superfamily Collagen-binding domain 2.22e-16
Family Collagen-binding domain 0.0026
Further Details:      
 
Domain Number 2 Region: 141-254
Classification Level Classification E-value
Superfamily Collagen-binding domain 0.00000000000000366
Family Collagen-binding domain 0.0019
Further Details:      
 
Domain Number 3 Region: 29-134
Classification Level Classification E-value
Superfamily Collagen-binding domain 0.0000000000615
Family Collagen-binding domain 0.0022
Further Details:      
 
Weak hits

Sequence:  471223.GWCH70_3082
Domain Number - Region: 391-453
Classification Level Classification E-value
Superfamily Carboxypeptidase regulatory domain-like 0.0824
Family Pre-dockerin domain 0.083
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) 471223.GWCH70_3082
Sequence length 539
Comment (Geobacillus WCH70)
Sequence
MRNCKKIFSFFFGLALIFTIPFLKTNTAFASSSTDLSFDTSVSGYITDTDDQQIYTINLK
QAGKVTVNLDSYIGGVNIALEDSNGNKVFDRYVSGGDPMDPVKRSFSEDLEAGTYYIKVY
QESNYTGKYDLEVNYEAAHNNEIEPNDGTVQAQPLAVNSQTVTGFISWNDSKDVYKVVLP
KAGRVTVNLDSYIGGANIALEDSNGNKVFDRYVSGGDPMDPVKRSFSEDLEAGTYYIKVY
QESTYTGKYDLRVNYEAVPNNEIEPNDGTVQAQPLAVNSQTVTGFISWNDSKDVYKVVLP
KAGRVTVNLDSYIGWVNIALEDSNGNKVFDRYVSGDDYPVKRSFSEDLEAGTYYIKVYQE
SNYTGKYTLSVQCPDLLPAPPTVNLVSNKSNAVTGKTVPNGMVSVKINSKVYTGKSDSKG
LFSIKIPTQKAGTKLYITVKDKYGYTSKERIVVVVDRIPPAAPIVNSVTSKSKVITGKAE
ANSTVIAYVGSQKIGSAKADKYGKYTIKITPKKAGTSIKVIAVDGAGNKSAGTVVKVKK
Download sequence
Identical sequences C5D8A6
gi|239828386|ref|YP_002951010.1| WP_015865128.1.59651 471223.GWCH70_3082

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]