SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 471852.Tcur_1658 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  471852.Tcur_1658
Domain Number 1 Region: 4-265
Classification Level Classification E-value
Superfamily Cgl1923-like 1.14e-85
Family Cgl1923-like 0.00000225
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) 471852.Tcur_1658
Sequence length 304
Comment (Thermomonospora curvata DSM 43183)
Sequence
MVRNPEDLYELSGDLPEMTGPVMLYCLDGFVDAGSVGQLVREHLLNSLEHRVIARFDADS
LIDYRARRPPMTFDRDRWLDYQAPELVVHLLRDEAGTPFLFLTGPEPDRQWEAFAAAVRS
LVERLGVRLSVTFHGIPMGVPHTRPVGLTMHATRPELVNRVSFFDRVQVPGSAAALLEYR
LGQAGHDVIGYAVHVPHYLAQAAYPTAAVAALDAVIGCTGLVLPSDALREASVRTETEIA
EQVAGNDEVEKVVRALEQQYDAFTGATGRQSLLAEEAEMPTAEELGAQFERFLAQQRRAD
GSDT
Download sequence
Identical sequences D1ABJ8
WP_012852018.1.83154 gi|269125902|ref|YP_003299272.1| 471852.Tcur_1658

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]