SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 471852.Tcur_2776 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  471852.Tcur_2776
Domain Number 1 Region: 1-379
Classification Level Classification E-value
Superfamily UDP-Glycosyltransferase/glycogen phosphorylase 5.71e-62
Family Gtf glycosyltransferase 0.02
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) 471852.Tcur_2776
Sequence length 380
Comment (Thermomonospora curvata DSM 43183)
Sequence
MRFLFMTGGGSAPIHASVPLAWAARTAGHEVIMAAPQENLDLIVGLGLPAAPVTRLGMGD
AMLKDREGNWLPMPTGEDDEMDFAGRGFARLAAASYEGAAKLVEAWRPDVVIGGEYTLVA
PLIAHRFGLPLVSHTWAIYDRTDVDWQGATDELRPELSRFGLEQVPAWDLFVDITPPSVR
PAHAEPAQPMRWTPGNSQVPLEPWMYTKGDRPRVVLTSGSRSMFVPNLGVDFFRPLLQTP
LLSSGEVEVIAATSEAVAAHLREEFPGLKAGYVPLDVVAPTADAVVHHGGGVTVMTLLNA
GTPQVVLPEIKYSAIPLRPVDEFGASITLPSHREPPEEVAAAISKILENPSYAGRAAKLA
EEIAGMPAPAEVVKKIEALV
Download sequence
Identical sequences D1A6R8
gi|269126990|ref|YP_003300360.1| 471852.Tcur_2776

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]