SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 471852.Tcur_2790 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  471852.Tcur_2790
Domain Number 1 Region: 1-377
Classification Level Classification E-value
Superfamily UDP-Glycosyltransferase/glycogen phosphorylase 3.38e-73
Family Gtf glycosyltransferase 0.066
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) 471852.Tcur_2790
Sequence length 380
Comment (Thermomonospora curvata DSM 43183)
Sequence
MKILMNTGPAHPLFFPIVPLAWALRAAGHEVLVATAESFEETVRQSGLAMTPVCGSLDMG
DVMARDREGNIVRPPDSYEGMTVEIGRGFGRLAARTVDGLRDLVARWRPDAIVTESYSFA
AVAAAARLHGVPWIKHTVGPGDLPIVTSATRELAPELERLGLDGLPEPDLIIDNCPPLLG
EITEGAQQVRYVPYGEPGAIPDWALQERTRPRVLVTLGSVQPQIGGLPMLAQMLGALSSL
DAELVVAVADHLVEGLGPLPDNVIAAGWVSLTSALPGCDAVVHHGGPGTMLASLCQGLPQ
VVIPGRGKPIDAVRRLAEFGAVHHLPPAELTPERLLESCRALLEEPGYAKQAVAAREEIA
GLPSPAAMVPVIERLVADAR
Download sequence
Identical sequences D1A6T1
471852.Tcur_2790 WP_012853119.1.83154 gi|269127003|ref|YP_003300373.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]