SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 479431.Namu_2785 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  479431.Namu_2785
Domain Number 1 Region: 2-252
Classification Level Classification E-value
Superfamily Cgl1923-like 1.7e-86
Family Cgl1923-like 0.00015
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) 479431.Namu_2785
Sequence length 286
Comment (Nakamurella multipartita DSM 44233)
Sequence
MSEFMPLRNPVMIAAFEGWNDAGDAASAAVEQLGLIWDAVPLTELDPEGFYDFQVTRPTV
RLVDGVTRTIEWPTTRLSVCRLPDSPSDVILVHGIEPNFRWRAFCDELLKIAVDHQVSKV
IGLGALLADVPHTRPIQVTGSAHDEQTAVSLGLTRSRYEGPTGISGVFQDACVQAGIPAL
SFWASVPHYVSQAPSPKATLALLHRVEEVLDVAVPLGNLPAQADEWEAEVSQIASEDEEI
SEYIRSLEEREEQDEPLKPASGESIAAEFERYLRRRGPKPGGDSWR
Download sequence
Identical sequences C8X8S6
479431.Namu_2785 WP_015748010.1.85990 gi|258652964|ref|YP_003202120.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]