SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 479433.Caci_0811 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  479433.Caci_0811
Domain Number - Region: 36-138
Classification Level Classification E-value
Superfamily Carbohydrate-binding domain 0.009
Family Cellulose-binding domain family III 0.045
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) 479433.Caci_0811
Sequence length 435
Comment (Catenulispora acidiphila DSM 44928)
Sequence
MRIQRSARSVVAGVAGTCLVTVAMGVLAATPAQARGSATLTLGPNNGAPGSSFTASFHMS
APGGPNACLGATVTFTFDATALGTAGLDQSCAATVSLPVPPAATNGAHKVKAVASGGASA
TANATFTVTGSTATPTTTAPTKTAPPSWSNSTTPYPGWTAPPFASQVIPTSTGPCDTSGP
HATAPDKAFLQIPAYSVGAHPANNGSKVIVEPATGALPLVSVGPGGMIPPQLGDGRHPYQ
NLELMETIDPNVSSKLRLAAAAGEPFGCLHVESFGGTGSGYSYLSFALKDATVISVQDAN
ADGSLFETAAPSVPSASTPAPAPGGKTTGTAKGNAPAAPATPTPPAPKAKFEKVVLGYSS
LSWEYQEAAGGAQAPIHRGAGTIVPPAPPAPLSYSNLVFAFGGLVAAAVALMFAYHSRRR
DLARRQRRRKASHAS
Download sequence
Identical sequences C7Q0W8
479433.Caci_0811 gi|256390023|ref|YP_003111587.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]