SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 479433.Caci_2737 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  479433.Caci_2737
Domain Number 1 Region: 1006-1145
Classification Level Classification E-value
Superfamily Ricin B-like lectins 2.64e-29
Family Ricin B-like 0.0026
Further Details:      
 
Domain Number 2 Region: 261-725
Classification Level Classification E-value
Superfamily Six-hairpin glycosidases 3.83e-19
Family Trehalase-like 0.082
Further Details:      
 
Domain Number 3 Region: 827-911
Classification Level Classification E-value
Superfamily Cadherin-like 0.00000000455
Family Cadherin 0.031
Further Details:      
 
Domain Number 4 Region: 919-1000
Classification Level Classification E-value
Superfamily Cadherin-like 0.00000000612
Family Cadherin 0.032
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) 479433.Caci_2737
Sequence length 1148
Comment (Catenulispora acidiphila DSM 44928)
Sequence
MSARHRLSRFIAAAAVFSLAPPLVVAIGSGTPALAATTTTAWQNGSFAQNVSGIVSRSNV
VIGKANTAATQFLPLGNGSLGVAEWAANGFTAQLNRSDTMPNRLSPGQVDIPGLSAMTSA
SNFVGYLDVYNGVLHESGGGMSLTAWVPAGKDELVVDVTGANPGTRQTASVNLWSGRGPT
ASASGSIASLAQTWVDNSQTGYSGKTFGAMAAITAGGSNVTASTSGSTQALVSFNPNSDG
TYRVIVASPSWAGGNANSTASSLIGSDTGASEASLLATQSAWWNTYWANSGLIEANSSDG
TAQYMENLHTLYLYFEAGTMHSGQYPGSQAGLADLFNFNQDHQAWYPAGYWLWNLRGQIQ
ANLDSGEFAQNIPIFDMYLNDLPAIQSWTGAQMNGKPGACVPETMRFNGNGYYWGGSITN
DASCAVASSPGFNAETITSGAEIALWVWQQYQDTGDVNFLQKYYPLLQQTSTFLLAWQSV
GSDGYLHAVANAHETQWQVQDPTTDIAADQALFTATVNAATRLNTDSSLVSQLRGALTHI
QPYARTDENSHSQLLGPSADSSGTDVIGTSYQPTAATHNVENLGLEPVWPFGVISDNTVV
NGDNLTALADRTYQHRQNVNNPDWTYDSIQAARLDMSSEVANDLVASTKSYQVYPSGLAA
WNPGSVDEPYIEQISNVAATLDEAFATDYDGTVRFAPAWPSGWDGSGRVYIQGGSKVDVQ
VEGGVLATAAIEAGSSGTMSVRNPWSGQQAQVVNGSTGAVVVAATNAATLSVPVTAGQSY
LVEQPATPTTSLPFAQVTGTAARGFRQLGSVSIGLGGNTLPAGNTVTVTSPGSQSGTVGT
AISALQIHATDSASGQTLSYSAAGLPPGLSISSSGLVSGTPSASGTFTVTVTATDSTGAS
GAASFTWTVGGGSGNVVSVTNPGSQSGTVGTAISGLQIQGTDSAGQTLTYTAGGLPTGLS
ISSSGLISGTPSASGTFTVTVTATDSTGASGAASFTWTISGGTTGFPGGYHSLVVAKSSL
CLDVFGNTSTAGAAIDQYTCNSQSNQQFQFLPIANGYGELQAQNSGQDVTVANSSTAQGT
PDIVQQPVNGAAASLWLPQQQSDGSWQFKNQNSGLCLDVYGNGSTTGQQLDQWPCKNAPG
TNQDFNPR
Download sequence
Identical sequences C7PZJ4
gi|256391928|ref|YP_003113492.1| WP_012786944.1.73754 479433.Caci_2737

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]