SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 479433.Caci_3603 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  479433.Caci_3603
Domain Number 1 Region: 34-253
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 1.58e-49
Family Xylanase/endoglucanase 11/12 0.00000511
Further Details:      
 
Domain Number 2 Region: 359-457
Classification Level Classification E-value
Superfamily Carbohydrate-binding domain 1.05e-32
Family Cellulose-binding domain family II 0.0000901
Further Details:      
 
Domain Number 3 Region: 264-352
Classification Level Classification E-value
Superfamily Fibronectin type III 6.28e-18
Family Fibronectin type III 0.00012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) 479433.Caci_3603
Sequence length 460
Comment (Catenulispora acidiphila DSM 44928)
Sequence
MARLLRARALAAALAIAFTGALSAIALPAAQAATTTCSGTGTIPAGDYTIQANEWNSSAQ
QCLTYNGATAWTVSTANFNLGGSGAPATYPSIFKGCHWGLCTSNNPFPIQMSKLGSAVSS
WDTTQPSSGAYDVAYDIWFNSSPTATGQPDGTEVMIWMNSRGGVQPFGSQTGNTTVAGHN
WNVWTGQQSSWKIISYVLNPGATSLSNLDLKAMFQDAVSRGSINPSNYLLDVEAGFEIWQ
GGQGLGTNSFSVSATAAGSGGGDTTAPSVPANLAVTGTTASSASLSWSPSTDNVGVTGYR
VYRNGAQVGTSSGTTFTDTGLSAATHYTYTVAAVDAAGNVSAPSTGATATTTSNGGGGGG
SGCTAAYSVTNQWNSGFTANVTVTNSGTAPINGWKVNWTWGGGQQITSLWNGTLSSSGSA
VTVTNMGYNGSVAPGANTSFGFQGAYSGTNGTPTLTCTAS
Download sequence
Identical sequences C7QAK8
479433.Caci_3603 WP_015792236.1.73754 gi|256392784|ref|YP_003114348.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]