SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 479433.Caci_4148 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  479433.Caci_4148
Domain Number 1 Region: 110-440
Classification Level Classification E-value
Superfamily Subtilisin-like 5.5e-37
Family Serine-carboxyl proteinase, SCP 0.00032
Further Details:      
 
Domain Number 2 Region: 455-535
Classification Level Classification E-value
Superfamily Cadherin-like 0.0000000706
Family Dystroglycan, N-terminal domain 0.071
Further Details:      
 
Domain Number 3 Region: 546-626
Classification Level Classification E-value
Superfamily Cadherin-like 0.0000000879
Family Dystroglycan, N-terminal domain 0.048
Further Details:      
 
Weak hits

Sequence:  479433.Caci_4148
Domain Number - Region: 636-716
Classification Level Classification E-value
Superfamily Galactose-binding domain-like 0.0187
Family CBM22 0.071
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) 479433.Caci_4148
Sequence length 788
Comment (Catenulispora acidiphila DSM 44928)
Sequence
MRISSRLRAFAGLATAVAMGGALAIGTASGATASAVPSSSAVTSATAALIAAEAAGSAHA
SQPALTAANSGATNACPSVIVVGHQSCFALKRNAVQPSAVSPNSIPSGVGYGPSQLQSAY
NLTSAAASNGAGRTIALVDAYDYPTAAADLAAYRSAAGLPAGNFTKINQNGQTSPLPSAP
PSGDDWTVEAALDMDMASAICPLCNIVLVEAQDDSSDGLYIAQAAAAARATYISNSWGGS
ESSTDPSSDNTYFKHATGTVTTVSAGDSDYGVSYPATSPNVVAVGGTALSTASNTRGWTE
SVWNTSTGSEGTGSGCSAYEAQPSWQTALNMPAGCSKRIDNDVAADADPATGVAVYDTYN
GDGGWNEVGGTSASSPMVAAMYALAGNAGANPAQDIYQHTSNFYDVTTGKDASSCSPAYL
CTAETGYDGPTGIGTPNGIAGLQTGGTSSETVSVSNPGNQTSTQGTAISTLQISATDSAS
KALTYSATGLPAGLSISSSGAITGTPTGTGSSSVTVTASSGTASGSTSFTWTVNPQGGTE
TVSVSNPGNQTSTQGTAISTLQISASDSAGKSLTYSATGLPAGLSISSSGAITGTPTGTG
TSSVTVTASSGTASGSTTFSWTVNPTGGGGCTATQLLGNPGFETGSASPWTASAGVIDSS
SSEPAHTGSWKAWLDGYGTTHTDTLSQKVSIPATCKTANFTFWLHIDTSETTTSTAYDKL
SVQVLNASGSVLGTLATYTNLNHNTGYAQRSFNLASYIGQTITLKFTGSEDLSLQTSFVI
DDTALNIN
Download sequence
Identical sequences C7QGG7
WP_015792741.1.73754 gi|256393289|ref|YP_003114853.1| 479433.Caci_4148

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]