SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 479433.Caci_5867 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  479433.Caci_5867
Domain Number - Region: 147-213
Classification Level Classification E-value
Superfamily Prim-pol domain 0.000168
Family PriA-like 0.011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) 479433.Caci_5867
Sequence length 357
Comment (Catenulispora acidiphila DSM 44928)
Sequence
MCPGVRMSVAGRSLPTMGSAEAHVEAGGRSVRISSPDKLLFPDADVTKLGLATYYAAVAD
GLFRGLANRPVALNRFPDGLGGKSFFTKSAPKGLPDWASTAHVTFPSGRTGDEVCVTEPA
TVLWTVQMGTLELHAWPVREADTDHPDELRIDLDPQPGTGFAEAVEVAREALALFEELGI
RPFVKTSGGRGLHLLVRIEPRWTFVEARRAVIALARELERRRPEMVTTSWWKEERGERIF
IDFNQMARDRMTVAPYSTRARPDAPVSMPVRWADLADVAPGDFTVKTVPDLFAKNGDANA
EIDDTAHSLDALLEMAERDEKDHGLGDMPYPPDFPKMPGEPKRVQPSKARHDQEGGS
Download sequence
Identical sequences C7QDV1
WP_015794454.1.73754 479433.Caci_5867 gi|256395002|ref|YP_003116566.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]