SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 485914.Hmuk_0696 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  485914.Hmuk_0696
Domain Number 1 Region: 834-885
Classification Level Classification E-value
Superfamily Type I dockerin domain 0.000000608
Family Type I dockerin domain 0.0038
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) 485914.Hmuk_0696
Sequence length 887
Comment (Halomicrobium mukohataei DSM 12286)
Sequence
MASSVAAALGASVAGVASGDEVGESDTPGAPGVNGSLKRFSTTSFGAEVTGPFVFQDGSL
LYSNQHPATGDRGGDFENSDVKANEAPFDRAGVGYFSGFTFELDGDNDDFSELSVPSTVD
EQGRIRSSEGEYVFLAHAREEIQGGDERFGVVQTPDGTEITQDNFAGTQYGAAATNPDCN
QFIPTNDDGTEGYLYTNWENSPGNVTRLPVSRTEEGEWEADLENATNLANTEPLRELGGT
RINCYGDRSPWNTMLSSEENYAHTRVSLTGTVGDIEAAGTGKGLVGGAAFWNRPNPVGIQ
SAIDDYYGDDSWFVQGYWALDGVEFLAYYLGAEQVDQTGDNENNTTNPIGDVYPNPYRYG
YHVDFREPAAETPEPIKYYVMGRTAWEAPDVLPDERTVYGCSDGDSKGIYKFVADEPIPS
YENPMDVEGTLYAPKITNDAASVADGGERDSPAAVSLEIEWLELGHASNAEIESWIAEYD
DVTQEEYLEAHAETDWTDDLATALEEADKAVVEDGNQNYITNDEIVEWADQYEQNGPENV
DEELRRVPFLETRAAAKEIGASIEFNKAEGVSSREGVSPGDFVYFGIAEFNDALADDEGD
VQMDRVDGGVVYRGQLERDYNVSTLEPVIVGPDFTDPAADADDALRNIDNVYVMDDGRVL
CCEDGFGGPARSYPNDGLYVYQPDAILDASAVAVSPESTGTVDLTMNAAPGGFAGGEFTV
SLTDPEVAAISDVTFPDAIGLQKVSVADDGSSATIRVGDIERSIQPGSLDVTLAGVEVTG
SAPGTTDLAVSVETIDDEAGVEIGVETRRGLVITGPPAAGGGAVPEDPDSDGRYEDVNGN
GRVDYDDVVLLFETIDSDAVRLNPEAYDFNDNGQIDFDDVVELYEEI
Download sequence
Identical sequences C7NZE1
WP_015761675.1.83741 gi|257386761|ref|YP_003176534.1| 485914.Hmuk_0696

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]