SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 485918.Cpin_4197 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  485918.Cpin_4197
Domain Number 1 Region: 674-849
Classification Level Classification E-value
Superfamily Fibronectin type III 3.86e-17
Family Fibronectin type III 0.0026
Further Details:      
 
Domain Number 2 Region: 872-969
Classification Level Classification E-value
Superfamily Collagen-binding domain 0.0000000000000732
Family Collagen-binding domain 0.0034
Further Details:      
 
Domain Number 3 Region: 196-408
Classification Level Classification E-value
Superfamily Metalloproteases ("zincins"), catalytic domain 0.0000000000314
Family Reprolysin-like 0.044
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) 485918.Cpin_4197
Sequence length 1063
Comment (Chitinophaga pinensis DSM 2588)
Sequence
MRKLLLLATALLCSTLSFAQDYWRPHTDGARISTDKAVARLAFPTEFKLFDLNFTPFRDQ
AFRSVGNKSAHATIISLPNADGQIEQFEITEASNFEPALQARFPDIRAFSGKGITDKYAT
LKLSISPEGIQTTVFRTGKENEFIEPYSADHTVYTVFKKRANTLPWKCSTPEQQLATDIG
SRIPDVAGRSTGDAKTLRLAQSVTAEYSNYFGATSASQVALVLAAVNATLTRCNGVYEKD
LAIHLNLVASTTSVFYYNASTDPYSSASSGAGGAWNGELQSTLNSVIGAANYDIGHLFGA
SGGGGNAGCIGCICVDNSKGSGFTSPADAIPQGDNFDIDYVVHEVGHQLGANHTFSMSNE
GTGVNVEPGSGITIMGYAGITSQDLAPHSIDIFHAASIAQIQANLATKSCPVTTVISGNN
ATPVVSAGGNFTIPISTPFVLTGSATDANPSDVLTYAWEQFDNASSSQTGSSSVASPTKA
TGPNWISLPPVTSPTRYFPKLATVLAGNLVSGPLTGGDAGANTEALSAVSRTLRFRLTVR
DNAPYSSTAPVTIGQTNFSDMTVTVSNTSGPFSVTAPNTAVSWAGNSSQNITWNVANTTA
SPVSCANVKISISTDGGNTFSTLVSSTPNDGSQSVIIPNTPTTTARIKVESVGNIFFDIS
NTNFTIVSGSSCTSPTGLSDSAITATSATITWADVSGAVSYDVDYKAVADTTWISAAAGI
TVTGVNLTGLLAGHTYDYRVRSHCASDSSSYAVGQLTTTPSASCSAPGGLSSTSVTTTAA
VISWTAVSGALSYDVDYKPAASATWINVQAGATATFANLTGLTATTTYDWRVRTNCSDGN
GAYASAQFTTQTPPTCANNKDTATNGNTAGAATIPFNTDITGLISPSGDIDHYKFVITTA
GTITITLGTLPGDYDLKLLNSAGTQLAISQAGGTSSETISRNMTPGTYYAQVYGYNGANS
TTSCYTLRVQLGTASRSTDVSSGDLPKVAVFPNPANNVVNVNLTGFKGKSAVTMYDVNGR
VVLRREMNPVNTQLDISTLPTGVYILKIRNGAKEVNMTKIIKQ
Download sequence
Identical sequences C7PFE9
485918.Cpin_4197 gi|256423202|ref|YP_003123855.1| WP_012791825.1.2976

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]