SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 485918.Cpin_4550 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  485918.Cpin_4550
Domain Number 1 Region: 334-482
Classification Level Classification E-value
Superfamily Thioredoxin-like 1.56e-38
Family Glutathione peroxidase-like 0.0027
Further Details:      
 
Domain Number 2 Region: 140-280
Classification Level Classification E-value
Superfamily TPR-like 0.0000000632
Family Tetratricopeptide repeat (TPR) 0.034
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) 485918.Cpin_4550
Sequence length 487
Comment (Chitinophaga pinensis DSM 2588)
Sequence
MRKTIPVLLSAVLATGIQSAYAQKKPAADTLTKHYQTLLKGNDADRSQLESEMYALLKTK
KEENWITASNFVYQLKKANVSDSIRKAAEKRFPGGILERNNAVQSIYDEKDPVNKEQLLS
AWIKKYPPKKFGPDRIIYDYARNAVGMAYTEAGNLPKALEYANSIESPFWKGQAWAGTAG
ILIKQGHYAEAKTLLRKAVDNAWEFKTTRKNETGAGFAAIGYPGYLSSYVACLYEEKQYD
SALIYIRRAEKAEDPVRPSVIEMYAKILLSKGDYDTAYTKLSNLAGRGLLNPITRKQLEE
AYTKVRGVSGFQPYLDSLKGHLNSNIEEEMAKQIIKQPAPNFTLKDVDGNTVSLADLKGK
TVVLDFWATWCGPCKASFPSMKKAMEKYKDDPNVKFLFVHTWEKEENAAVSAKKFITQNN
YPFQVLMDLKDPNTGENKVVSSYEVKGIPTKFVIDKNGDIRFRFTGFTAGEDAAVSEVAA
MINLANK
Download sequence
Identical sequences C7PJC4
485918.Cpin_4550 gi|256423540|ref|YP_003124193.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]