SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 490899.DKAM_0023 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  490899.DKAM_0023
Domain Number - Region: 446-528
Classification Level Classification E-value
Superfamily Prefoldin 0.0228
Family Prefoldin 0.017
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) 490899.DKAM_0023
Sequence length 655
Comment (Desulfurococcus kamchatkensis 1221n)
Sequence
MGSGINRCFKLSNYLGDTIVVTVIGVDIQPGSSPNSRRQPLYSAVVLRNGEIIASFEDVE
LYRLLRLVLEYHVDIIAVDNIYELAPSENELRRIFELLPGNVKVVQVTGPPNDARDVNSV
ARELGIDTVIETPLKTAYINALAAYRGIGYEVRLFAEKTRIVVTKGRSVTQGGMSRDRFL
RCIRASIAQATKEIKRILDENKLDYDMVIKRSKGGLEKSVFIVYAPRESLYGLIKPLKYK
NVKIIIKPYASRKSIEPVSDQARKPVIVGVDPGMSIGVSVLTLDGEPVLITSMKSPDRDE
IVNLISRIGKPVVVATDVSKPPETVVKLASMLNAVLYVPEQDITIDEKNRIAREYSEKYV
VNIPDSHTRDALAAAVKAYNNYKATIEEVKSKLANMKKVDRYQLIAEIIRGKPFSEVLEE
HFKRSIPKIPPVVEEKMKPTTTPVCEKLSEKVNTLEALVRKLLDEIERKDLYIKDLELEL
KLTRSRKPGIEDYERKISALQNELEALRRKIEDKDNVIRELYEKLLQLEEHVVKLGRGDL
VMIPKVSTVRREGGLVNRGVYMEKVLEISSELKNILTSGRGFIVSPVVAVDPLKERIPVV
KPEIIYDLGDYVIVEKEVIEKANELWRKIDELIELERHERILRMIEEYQRSRKNS
Download sequence
Identical sequences B8D381
490899.DKAM_0023 gi|218883337|ref|YP_002427719.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]