SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 490899.DKAM_0610 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  490899.DKAM_0610
Domain Number 1 Region: 1-100,129-235,645-739
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 6.91e-30
Family ABC transporter ATPase domain-like 0.0039
Further Details:      
 
Domain Number 2 Region: 354-453
Classification Level Classification E-value
Superfamily Rad50 coiled-coil Zn hook 0.00000000288
Family Rad50 coiled-coil Zn hook 0.0049
Further Details:      
 
Weak hits

Sequence:  490899.DKAM_0610
Domain Number - Region: 263-361
Classification Level Classification E-value
Superfamily Prefoldin 0.00314
Family Prefoldin 0.0093
Further Details:      
 
Domain Number - Region: 421-536
Classification Level Classification E-value
Superfamily Methyl-accepting chemotaxis protein (MCP) signaling domain 0.0628
Family Methyl-accepting chemotaxis protein (MCP) signaling domain 0.0081
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) 490899.DKAM_0610
Sequence length 818
Comment (Desulfurococcus kamchatkensis 1221n)
Sequence
MRIYGLMLENIRSFKNEYIVFPKKGVTVIHGETGSGKTSILMSISAALFGLQKEGKDPFR
AFAYPTGKDLLRADALRGRIRLLFEHEGRVYLVEREFKRSSNSVVNVDRNRLEEYIIKED
KLIKVNSLILGTEELNKRIREILGIKERAREKPLLFTSVLYAPQFNIHEILSLDSEERGE
IIERSLGLYKYKEYKNNSNAVRDVIKDKIDELTDKIDGLKKKLKDKNKEKLLEEKQRLEK
QLKELEKILVEKQKERDELDKRIKEHQNRLRDMERRIGELQSRIGQARKQEARLKDVRNE
LAKIALNLGKNASTGYTELLEELRRREREIEGKVRELQDIESELVDKRKEIEEELNEAKR
KREDIMMRLGRLEADEENLTRQEQELNKQLEKYRDLLNKGICPLCLQPIPHEHGIKLIDE
VQGRLEEVGKKIRELKEEETSRYKELEDINKRINALEENREEVEEKLDKVRRDSTRLLQE
LLSLKHTAEKINSLVDEASRIEKEISEARSLEEELARINSEKENTISIIHELEDKYREAK
EKLEGLIAEKAGTEKSIKYIELEIQDIEKEEDELRQLEDEKKFHEWMDTTMNILDKLVDE
VEKRVSLEMVSEFRRIFYMILDTLLQGQPVEVGIRDDFTIEPKIRIGGRIYTISSLSGGQ
NIAISLAYRLALNATVRTYSPFLRKTVLILDEPTTGFSQELVKRLSEVLRKIGDLEGQVI
VVTHDELLKEIGDCKIMLERDPINHVSKVREQECDIEEFNKFKNLVEGLLRGSLQVDTVK
MEKIEVEPAGFKPEVRLGAGTVQQAKRKSLFDFHDKPK
Download sequence
Identical sequences B8D4A5
WP_012608277.1.40753 490899.DKAM_0610 gi|218883921|ref|YP_002428303.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]