SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 490899.DKAM_0955 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  490899.DKAM_0955
Domain Number 1 Region: 2-138
Classification Level Classification E-value
Superfamily HydA/Nqo6-like 5.23e-36
Family Nq06-like 0.00043
Further Details:      
 
Domain Number 2 Region: 204-327
Classification Level Classification E-value
Superfamily Nqo5-like 6.93e-33
Family Nqo5-like 0.00057
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) 490899.DKAM_0955
Sequence length 337
Comment (Desulfurococcus kamchatkensis 1221n)
Sequence
MLERIARWAYARSLWMIHYCSACGAVEFPPLVMAPLDWERYGYMPTPSPRQSDLYIGMGY
LTKKTVKLVLNMYRQMPEPKLVLAGCNCTSTGGPYWDSYATYKRLDDFIEVEGWVPGCMP
MPDDYLSMIEYVRKDLGKRPLNAYVSKIKPDAFKKISEWEELEKQWRKEYEEKIKEDSSK
PVSYEFKETYPSCYEKDEKSKICKTSVNPEKIRDALMDLKNKGHVLFVNINTVDYPDKGV
IEVYYVLENPSDGSQVWVKTYAKRASPEIDSVHDIFPLAKYIEREVYEFMGVVFRNNPEL
KKWILDGNWEGPPPLRKDVDTAGFVMKTMYGGYKYGR
Download sequence
Identical sequences B8D5A0
490899.DKAM_0955 gi|218884266|ref|YP_002428648.1| WP_012608622.1.40753

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]