SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 490899.DKAM_1108 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  490899.DKAM_1108
Domain Number 1 Region: 17-143
Classification Level Classification E-value
Superfamily Prefoldin 0.00000000000353
Family Prefoldin 0.0051
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) 490899.DKAM_1108
Sequence length 156
Comment (Desulfurococcus kamchatkensis 1221n)
Sequence
MNSGSDAKEVKEAGRIQLEEILVRFNELREYANILASTINTYLTQQRELQLALETLKNLP
EDGGEGYIILDRLSSAMIPAVINKEWSKGILVHLGLGYYLKADKAKALEIISKRSSNVER
VLGELQKRYSVVLEELNRLQQLLSRGYGGSQSKGGG
Download sequence
Identical sequences B8D5Q3
gi|218884419|ref|YP_002428801.1| 490899.DKAM_1108 WP_012608775.1.1384 WP_012608775.1.40753

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]