SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 490899.DKAM_1243 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  490899.DKAM_1243
Domain Number 1 Region: 2-76,166-337
Classification Level Classification E-value
Superfamily Phosphoenolpyruvate/pyruvate domain 1.5e-70
Family Pyruvate kinase 0.000056
Further Details:      
 
Domain Number 2 Region: 71-164
Classification Level Classification E-value
Superfamily PK beta-barrel domain-like 0.00000000000000855
Family Pyruvate kinase beta-barrel domain 0.0023
Further Details:      
 
Domain Number 3 Region: 321-462
Classification Level Classification E-value
Superfamily PK C-terminal domain-like 0.000000000000201
Family Pyruvate kinase, C-terminal domain 0.009
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) 490899.DKAM_1243
Sequence length 474
Comment (Desulfurococcus kamchatkensis 1221n)
Sequence
MLGRVKIIATLGPSIRDYNVIKKMIKEGVAGFRINCAHGDENTWIEYVKLVRDASSDLGK
AIPLILDTPGPQVRSGDFQEFTVKQGDNVVISSNPGNGGGEKKIIIVPAKEFYTAASTGD
IILYGDGEISFRVINTGEDFVEVVVLNDGVVKPRKKVVIEGKEYPVAFPSEVDRRVFKFA
SDVKATFVALSYVRSLKDVELAKDVLSRHGWMPGFIAKIETRSGFINMGEIIEVVDGVIV
ARGDLGLHFPLEKLPLIQKEIVREAIKHGKTVIIATEILESMVNNPRPSRSDVVDLYNSV
EDLVDAVLFTNETAIGKYPVEVVRWTRRIIEAAESELSRALISEYRGAIKAMNLLDKYVQ
GLVLLAESLGGTIVGYSKTGRMPTLVSKYRPQIKVYIGVSNRFLAEKLSIKYGLEITDMS
QVIQDNLEKEYEVGVEKLVETLVKQNYLRPGDIVVETYAKPQTSIHEIRIRQII
Download sequence
Identical sequences B8D638
490899.DKAM_1243 gi|218884554|ref|YP_002428936.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]